Dataset for protein Bmf of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6B5G4_BMF-02      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K6B5G4_BMF-01      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K6B5G4_BMF-04      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K6B5G4_BMF-03      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
                       **************************************************

A0A2K6B5G4_BMF-02      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K6B5G4_BMF-01      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K6B5G4_BMF-04      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K6B5G4_BMF-03      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA
                       ***********************************************. *

A0A2K6B5G4_BMF-02      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2K6B5G4_BMF-01      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2K6B5G4_BMF-04      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2K6B5G4_BMF-03      EPKSRVVADPPL-----PAQPCFEWRR-----------------------
                         .  : *. *         *  :*..                       

A0A2K6B5G4_BMF-02      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6B5G4_BMF-01      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6B5G4_BMF-04      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6B5G4_BMF-03      ------------------------EQERGGP---
                                               *::*.*.   

© 1998-2018