Dataset for protein Bad of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6E7J3_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
A0A2K6E7J3_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
A0A2K6E7J3_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
                       **************************************************

A0A2K6E7J3_BAD-03      QQEQPTSSSHHGG--------RAWYSPSWESEDSENPSARMLAEASARMS
A0A2K6E7J3_BAD-01      QQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSA
A0A2K6E7J3_BAD-02      QQEQPTSSSHHGG---------------TSSPEERGHSDADAAKLQLDAS
                       *************                 . :.   .           :

A0A2K6E7J3_BAD-03      APATDSEAQHAENVKLKA-------LGLWRPAVATAPTPRGRRRTKGWRR
A0A2K6E7J3_BAD-01      PPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQ--MRQSSSWTR
A0A2K6E7J3_BAD-02      LPVLVGSELGQGKLRTLPVTFA------PRPETPPALTVLVGHLGYGRKC
                        *   .      ::.  .           **  . : *    .   ..  

A0A2K6E7J3_BAD-03      SPAPFGAARAPRPPTSGQHSVMAASSGG
A0A2K6E7J3_BAD-01      VFQSWWDRNLGRGSSAPSQ---------
A0A2K6E7J3_BAD-02      FPQALCKRGSVLPLSVGGLTQIPFRCM-
                          .          :             

© 1998-2018