Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1D5QGJ8_PMAIP1-      -MPGKKARKNAQPSPTRAQAAGTAGTAGTARDQAGFGIGMQLHYTRGKKL
F7FFP6_BBC3-03          ---IKFGVGSARACPCQVPRASSA--TWVPCQICGPQPSLLLAEQHLESP
F7CM09_BMF-02           ----MEPSRCVEELEDDVFQPEDGE--------------------PGAQP
F7GVS7_BAD-04           MEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKVSAGPPPRP
A0A1D5R1E4_HRK-01       ----MCPCPLHRGRGPPAVCACSAGRLGLR---------------SSAA-
F7GVS7_BAD-01           ----MFQIPEFEPSEQEDSSSAERGLGPSP---------------AGDRP
F7GVS7_BAD-03           ----MFQIPEFEPSEQEDSSSAERGLGPSP---------------AGDRP
F7GVS7_BAD-02           ----MFQIPEFEPSEQEDSSSAERGLGPSP---------------AGDRP
F7HHA9_BCL2L11-08       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-05       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-04       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-02       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-03       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-01       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-06       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-07       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-09       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
                                                                          

A0A1D5QGJ8_PMAIP1-      V------SSSPLVLPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESD
F7FFP6_BBC3-03          V------PSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
F7CM09_BMF-02           GSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPA
F7GVS7_BAD-04           PRAGLSLPCPKARPDLMSHDPS----------------------------
A0A1D5R1E4_HRK-01       -------QLTAARLKALGDELHQRTMWRRRARSRRAPASGALPTYWPWLC
F7GVS7_BAD-01           SDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGA---GAVETRSRHSSYPA
F7GVS7_BAD-03           SDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGRAWYSPSWESEDSENPSA
F7GVS7_BAD-02           SDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGT---SSPEERGHSDADAA
F7HHA9_BCL2L11-08       P------QLRPGAPTSLQTEPQ----------------------------
F7HHA9_BCL2L11-05       P------QLRPGAPTSLQTEPQ----------------------------
F7HHA9_BCL2L11-04       P------QLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPAS
F7HHA9_BCL2L11-02       P------QLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPAS
F7HHA9_BCL2L11-03       P------QLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPAS
F7HHA9_BCL2L11-01       P------QLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPAS
F7HHA9_BCL2L11-06       P------QLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPAS
F7HHA9_BCL2L11-07       P------QLRPGAPTSLQTEPQ----------------------------
F7HHA9_BCL2L11-09       P------QLRPGAPTSLQTEPQ----------------------------
                                                                          

A0A1D5QGJ8_PMAIP1-      SQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQ--FEERLHCN--------
F7FFP6_BBC3-03          YERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN--------
F7CM09_BMF-02           SPSQGVMLPCGVTEEPQRL-------FYGNAGYRLPLPASFPAVLPIGEQ
F7GVS7_BAD-04           -----------------------------------------------PTP
A0A1D5R1E4_HRK-01       AAAQVAALAAWLLGRRNL--------------------------------
F7GVS7_BAD-01           GTEEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGL
F7GVS7_BAD-03           RMLAEASARMSAPATDSEAQHAE---------NVKLKALGL-WRPGVATA
F7GVS7_BAD-02           KLQLDASLPVLVGSELGQG---------------KLRTLPVTFAPRPETP
F7HHA9_BCL2L11-08       --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
F7HHA9_BCL2L11-04       PGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSP
F7HHA9_BCL2L11-02       PGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSP
F7HHA9_BCL2L11-03       PGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSP
F7HHA9_BCL2L11-01       PGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSP
F7HHA9_BCL2L11-06       PGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSP
F7HHA9_BCL2L11-07       --------------------------------DRSPAPMSCDKSTQTPSP
F7HHA9_BCL2L11-09       --------------------------------DRSPAPMSCDKSTQTPSP
                                                                          

A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
F7CM09_BMF-02           PPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHN
F7GVS7_BAD-04           SCPFLAP-------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
F7GVS7_BAD-01           PRPKSAG--------------TATQMRQSSSWTRVFQSWWDRNLGRGSSA
F7GVS7_BAD-03           PTPRGRR--------------RTKGWRRSPAPFGAARAPRPPTSGQHSVM
F7GVS7_BAD-02           PALTVLV--------------GHLGYGRKCFPQALCK--------RGSVL
F7HHA9_BCL2L11-08       ---------------------VSLCCPSWSALVLSWLTATSNSQV-----
F7HHA9_BCL2L11-05       ---------------------ASRRQAEPADMRPEIRIAQELRRIGDEFN
F7HHA9_BCL2L11-04       PCQAFNHYLSAM---------ASRRQAEPADMRPEIRIAQELRRIGDEFN
F7HHA9_BCL2L11-02       PCQAFNHYLSAM---------ASRRQAEPADMRPEIRIAQELRRIGDEFN
F7HHA9_BCL2L11-03       PCQAFNHYLSAM---------VREIEEVVV--------------------
F7HHA9_BCL2L11-01       PCQAFNHYLSAM---------GIFE-------------------------
F7HHA9_BCL2L11-06       PCQAFNHYLSAM---------ANWD-------------------------
F7HHA9_BCL2L11-07       PCQAFNHYLSAMDEATGSSLGIALHREVQWPLEWLA--------------
F7HHA9_BCL2L11-09       PCQAFNHYLSAM---------VVILEDIGDSSLWFGFIFTGLDLYGHHHS
                                                                          

A0A1D5QGJ8_PMAIP1-      ---------------
F7FFP6_BBC3-03          ---------------
F7CM09_BMF-02           LALNGEQNRNGAGPR
F7GVS7_BAD-04           ---------------
A0A1D5R1E4_HRK-01       ---------------
F7GVS7_BAD-01           PSQ------------
F7GVS7_BAD-03           AASSGG---------
F7GVS7_BAD-02           PLSVGGLTQIPFRCM
F7HHA9_BCL2L11-08       -----QAVLLPQPPK
F7HHA9_BCL2L11-05       AYYARRLAELLASST
F7HHA9_BCL2L11-04       AYYARRLEK------
F7HHA9_BCL2L11-02       AYYARRMSLPPD---
F7HHA9_BCL2L11-03       ---------------
F7HHA9_BCL2L11-01       ---------------
F7HHA9_BCL2L11-06       ---------------
F7HHA9_BCL2L11-07       ---------------
F7HHA9_BCL2L11-09       QDTEQLNHKDFS---
                                       

© 1998-2019