Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1D5QGJ8_PMAIP1-      MPGKKARKNAQPSPTRAQAAGTAGTAGTARDQAGFGIGMQLHYTRGKKLV
F7FFP6_BBC3-03          --IKFGVGSARACPCQVPRASSA--TWVPCQICGPQPSLLLAEQHLESPV
F7CM09_BMF-02           ---------MEPSRC----------------VEELEDDVFQPEDGEPGAQ
F7GVS7_BAD-04           -------MEEEPSPFRGRSRSAP----PNLWAAQRYGRELR------RMS
F7GVS7_BAD-01           MFQIPEFEPSEQEDS-----SSA----ERGLGPSPAGDRPSDSGKHHRQA
F7GVS7_BAD-02           MFQIPEFEPSEQEDS-----SSA----ERGLGPSPAGDRPSDSGKHHRQA
F7GVS7_BAD-03           MFQIPEFEPSEQEDS-----SSA----ERGLGPSPAGDRPSDSGKHHRQA
A0A1D5R1E4_HRK-01       MCPCPLHRGRGPPAV-----------------CACSAGRLGLRSSAAQLT
F7HHA9_BCL2L11-08       -------MAKQPSDV-----SSE---------CDREGRQLQPAERPPQLR
F7HHA9_BCL2L11-05       -------MAKQPSDV-----SSE---------CDREGRQLQPAERPPQLR
F7HHA9_BCL2L11-07       -------MAKQPSDV-----SSE---------CDREGRQLQPAERPPQLR
F7HHA9_BCL2L11-09       -------MAKQPSDV-----SSE---------CDREGRQLQPAERPPQLR
F7HHA9_BCL2L11-03       -------MAKQPSDV-----SSE---------CDREGRQLQPAERPPQLR
F7HHA9_BCL2L11-06       -------MAKQPSDV-----SSE---------CDREGRQLQPAERPPQLR
F7HHA9_BCL2L11-01       -------MAKQPSDV-----SSE---------CDREGRQLQPAERPPQLR
F7HHA9_BCL2L11-02       -------MAKQPSDV-----SSE---------CDREGRQLQPAERPPQLR
F7HHA9_BCL2L11-04       -------MAKQPSDV-----SSE---------CDREGRQLQPAERPPQLR
                                                                          

A0A1D5QGJ8_PMAIP1-      SSSPLVLPRGHEEQVQVARSRVC------------YSTQEIWRQTELPAE
F7FFP6_BBC3-03          PSAPGALAGGPTQAAPGVRGEEE------------QWAREIGAQLRRMAD
F7CM09_BMF-02           PGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGP
F7GVS7_BAD-04           DEFVDSFKVSAGPPPRPPRAGLS----LPCPKARPDLMSHDPS-------
F7GVS7_BAD-01           PGLLWDASHQQEQPTSSSHHGGA-------GAVETRSRHSSYPAGTEEDE
F7GVS7_BAD-02           PGLLWDASHQQEQPTSSSHHGGT-------SSPEERGHSDADAAKLQLDA
F7GVS7_BAD-03           PGLLWDASHQQEQPTSSSHHGGR----AWYSPSWESEDSENPSARMLAEA
A0A1D5R1E4_HRK-01       AARLKALGDELH--------------------------------------
F7HHA9_BCL2L11-08       PGAPTSLQTEPQ--------------------------------------
F7HHA9_BCL2L11-05       PGAPTSLQTEPQ--------------------------------------
F7HHA9_BCL2L11-07       PGAPTSLQTEPQ--------------------------------------
F7HHA9_BCL2L11-09       PGAPTSLQTEPQ--------------------------------------
F7HHA9_BCL2L11-03       PGAPTSLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFAT
F7HHA9_BCL2L11-06       PGAPTSLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFAT
F7HHA9_BCL2L11-01       PGAPTSLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFAT
F7HHA9_BCL2L11-02       PGAPTSLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFAT
F7HHA9_BCL2L11-04       PGAPTSLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFAT
                                                                          

A0A1D5QGJ8_PMAIP1-      TSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQ--FEERLHCN---
F7FFP6_BBC3-03          DLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---
F7CM09_BMF-02           ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQW
F7GVS7_BAD-04           -----------------------------------------PTPSCP---
F7GVS7_BAD-01           GMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRP---
F7GVS7_BAD-02           SLPVLVGSELGQG---------------KLRTLPVTFAPRPETPPAL---
F7GVS7_BAD-03           SARMSAPATDSEAQHAE---------NVKLKALGL-WRPGVATAPTP---
A0A1D5R1E4_HRK-01       -----------------------------QRTMWRRRARSRRAPASG---
F7HHA9_BCL2L11-08       ------------------------------VSLCC------PSWSAL---
F7HHA9_BCL2L11-05       --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------DRSPAPMSCDKSTQTPSPPCQ---
F7HHA9_BCL2L11-09       --------------------------DRSPAPMSCDKSTQTPSPPCQ---
F7HHA9_BCL2L11-03       RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ---
F7HHA9_BCL2L11-06       RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ---
F7HHA9_BCL2L11-01       RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ---
F7HHA9_BCL2L11-02       RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ---
F7HHA9_BCL2L11-04       RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ---
                                                                          

A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
F7CM09_BMF-02           QHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGE
F7GVS7_BAD-04           ------FLAP----------------------------------------
F7GVS7_BAD-01           ------KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------
F7GVS7_BAD-02           ------TVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQIP
F7GVS7_BAD-03           ------RGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG-----
A0A1D5R1E4_HRK-01       ------ALPTYWPWLCAAAQVAALAAWLLGRRNL----------------
F7HHA9_BCL2L11-08       ------VLSWLTATSNSQVQAVLLPQPPK---------------------
F7HHA9_BCL2L11-05       ---------------ASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARR
F7HHA9_BCL2L11-07       ------AFNHYLSAMDEAT--------------------GSSLGIALHRE
F7HHA9_BCL2L11-09       ------AFNHYLSAMVVILEDIGDSSLWFGFIFTGLDLYGHHHSQDTEQL
F7HHA9_BCL2L11-03       ------AFNHYLSAMVREIEEVVV--------------------------
F7HHA9_BCL2L11-06       ------AFNHYLSAMANWD-------------------------------
F7HHA9_BCL2L11-01       ------AFNHYLSAMGIFE-------------------------------
F7HHA9_BCL2L11-02       ------AFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARR
F7HHA9_BCL2L11-04       ------AFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARR
                                                                          

A0A1D5QGJ8_PMAIP1-      ---------
F7FFP6_BBC3-03          ---------
F7CM09_BMF-02           QNRNGAGPR
F7GVS7_BAD-04           ---------
F7GVS7_BAD-01           ---------
F7GVS7_BAD-02           FRCM-----
F7GVS7_BAD-03           ---------
A0A1D5R1E4_HRK-01       ---------
F7HHA9_BCL2L11-08       ---------
F7HHA9_BCL2L11-05       LAELLASST
F7HHA9_BCL2L11-07       VQWPLEWLA
F7HHA9_BCL2L11-09       NHKDFS---
F7HHA9_BCL2L11-03       ---------
F7HHA9_BCL2L11-06       ---------
F7HHA9_BCL2L11-01       ---------
F7HHA9_BCL2L11-02       MSLPPD---
F7HHA9_BCL2L11-04       LEK------
                                 

© 1998-2018