Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1D5QGJ8_PMAIP1-      MPGKKARKNAQPSPTRAQAAGTAGTAGTARDQAGFGIGMQLHYTRGKKLV
F7FFP6_BBC3-03          --IKFGVGSARACPCQVPRASSA--TWVPCQICGPQPSLLLAEQHLESPV
F7CM09_BMF-02           ---------------MEPSRCVEE-------LEDDVFQPEDGEPGAQPGS
F7GVS7_BAD-04           -------------MEEEPSPFRGR-------------------SRSAPPN
F7GVS7_BAD-01           ------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGL
F7GVS7_BAD-02           ------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGL
F7GVS7_BAD-03           ------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGL
A0A1D5R1E4_HRK-01       ------MCPCPLHRGRGPPAV--------CACSAGRLGLRSSAAQLTAAR
F7HHA9_BCL2L11-08       -------------MAKQPSDVSSE-----CDREGRQLQPAERPPQLRPGA
F7HHA9_BCL2L11-05       -------------MAKQPSDVSSE-----CDREGRQLQPAERPPQLRPGA
F7HHA9_BCL2L11-04       -------------MAKQPSDVSSE-----CDREGRQLQPAERPPQLRPGA
F7HHA9_BCL2L11-02       -------------MAKQPSDVSSE-----CDREGRQLQPAERPPQLRPGA
F7HHA9_BCL2L11-03       -------------MAKQPSDVSSE-----CDREGRQLQPAERPPQLRPGA
F7HHA9_BCL2L11-01       -------------MAKQPSDVSSE-----CDREGRQLQPAERPPQLRPGA
F7HHA9_BCL2L11-06       -------------MAKQPSDVSSE-----CDREGRQLQPAERPPQLRPGA
F7HHA9_BCL2L11-07       -------------MAKQPSDVSSE-----CDREGRQLQPAERPPQLRPGA
F7HHA9_BCL2L11-09       -------------MAKQPSDVSSE-----CDREGRQLQPAERPPQLRPGA
                                                                          

A0A1D5QGJ8_PMAIP1-      SSSPLVLPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLR
F7FFP6_BBC3-03          PSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQE
F7CM09_BMF-02           SLSADLFAQSLLDCPLSRLQ-------------LFPLTHCCGPGLRPTSQ
F7GVS7_BAD-04           LWAAQRYGR-----------------------------------------
F7GVS7_BAD-01           LWDASHQQEQPTSSSHHGGA---GAVETRSRHSSYPAGTEEDEGMEEEPS
F7GVS7_BAD-02           LWDASHQQEQPTSSSHHGGT---SSPEERGHSDADAAKLQLDASLPVLVG
F7GVS7_BAD-03           LWDASHQQEQPTSSSHHGGRAWYSPSWESEDSENPSARMLAEASARMSAP
A0A1D5R1E4_HRK-01       LKALGDELH-----------------------------------------
F7HHA9_BCL2L11-08       PTSLQTEPQ-----------------------------------------
F7HHA9_BCL2L11-05       PTSLQTEPQ-----------------------------------------
F7HHA9_BCL2L11-04       PTSLQTEPQGNPEGNHGGEG-----------------DSCPHGSPQGPLA
F7HHA9_BCL2L11-02       PTSLQTEPQGNPEGNHGGEG-----------------DSCPHGSPQGPLA
F7HHA9_BCL2L11-03       PTSLQTEPQGNPEGNHGGEG-----------------DSCPHGSPQGPLA
F7HHA9_BCL2L11-01       PTSLQTEPQGNPEGNHGGEG-----------------DSCPHGSPQGPLA
F7HHA9_BCL2L11-06       PTSLQTEPQGNPEGNHGGEG-----------------DSCPHGSPQGPLA
F7HHA9_BCL2L11-07       PTSLQTEPQ-----------------------------------------
F7HHA9_BCL2L11-09       PTSLQTEPQ-----------------------------------------
                                                                          

A0A1D5QGJ8_PMAIP1-      NLTASKTCIRGLQKRLFLRRCTLHQ--FEERLHCN---------------
F7FFP6_BBC3-03          EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
F7CM09_BMF-02           EDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLP
F7GVS7_BAD-04           ---------------------ELRRMSDEFVDSFKVSAGPPPRPPRAGLS
F7GVS7_BAD-01           PFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMR
F7GVS7_BAD-02           SELGQG---------------KLRTLPVTFAPRPETPPALTVLVGHLGYG
F7GVS7_BAD-03           ATDSEAQHAE---------NVKLKALGL-WRPGVATAPTPRGRRRTKGWR
A0A1D5R1E4_HRK-01       ---------------------------------------QRTMWRRRARS
F7HHA9_BCL2L11-08       ----------------------------------------VSLCC-----
F7HHA9_BCL2L11-05       --------------------------------------------------
F7HHA9_BCL2L11-04       PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
F7HHA9_BCL2L11-02       PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
F7HHA9_BCL2L11-03       PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
F7HHA9_BCL2L11-01       PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
F7HHA9_BCL2L11-06       PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
F7HHA9_BCL2L11-07       ------------------------------------DRSPAPMSCDKSTQ
F7HHA9_BCL2L11-09       ------------------------------------DRSPAPMSCDKSTQ
                                                                          

A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
F7CM09_BMF-02           IGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILL
F7GVS7_BAD-04           LPCPKAR------------------PDLMSHDPSPTPSCPFLAP------
F7GVS7_BAD-01           QSSSWTRVFQSWWDRN---------LGRGSSAPSQ---------------
F7GVS7_BAD-02           RKCFPQALCK-----------------RGSVLPLSVGGLTQIPFRCM---
F7GVS7_BAD-03           RSPAPFGAARAPRPPT---------SGQHSVMAASSGG------------
A0A1D5R1E4_HRK-01       RRAPASGALPTYWPWL---------CAAAQVAALAAWLLGRRNL------
F7HHA9_BCL2L11-08       -PSWSALVLSWLTATS---------NSQVQAVLLPQPPK-----------
F7HHA9_BCL2L11-05       -------------------------ASRRQAEPADMRPEIRIAQELRRIG
F7HHA9_BCL2L11-04       TPSPPCQAFNHYLSAM---------ASRRQAEPADMRPEIRIAQELRRIG
F7HHA9_BCL2L11-02       TPSPPCQAFNHYLSAM---------ASRRQAEPADMRPEIRIAQELRRIG
F7HHA9_BCL2L11-03       TPSPPCQAFNHYLSAM---------VREIEEVVV----------------
F7HHA9_BCL2L11-01       TPSPPCQAFNHYLSAM---------GIFE---------------------
F7HHA9_BCL2L11-06       TPSPPCQAFNHYLSAM---------ANWD---------------------
F7HHA9_BCL2L11-07       TPSPPCQAFNHYLSAMDEATGSSLGIALHREVQWPLEWLA----------
F7HHA9_BCL2L11-09       TPSPPCQAFNHYLSAM---------VVILEDIGDSSLWFGFIFTGLDLYG
                                                                          

A0A1D5QGJ8_PMAIP1-      -------------------
F7FFP6_BBC3-03          -------------------
F7CM09_BMF-02           FLHNLALNGEQNRNGAGPR
F7GVS7_BAD-04           -------------------
F7GVS7_BAD-01           -------------------
F7GVS7_BAD-02           -------------------
F7GVS7_BAD-03           -------------------
A0A1D5R1E4_HRK-01       -------------------
F7HHA9_BCL2L11-08       -------------------
F7HHA9_BCL2L11-05       DEFNAYYARRLAELLASST
F7HHA9_BCL2L11-04       DEFNAYYARRLEK------
F7HHA9_BCL2L11-02       DEFNAYYARRMSLPPD---
F7HHA9_BCL2L11-03       -------------------
F7HHA9_BCL2L11-01       -------------------
F7HHA9_BCL2L11-06       -------------------
F7HHA9_BCL2L11-07       -------------------
F7HHA9_BCL2L11-09       HHHSQDTEQLNHKDFS---
                                           

© 1998-2019