Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1D5QGJ8_PMAIP1-      -MPGKKARKNAQPSPTRAQAAGTAGTAGTARDQAGFGIGMQLHYTRGKKL
F7FFP6_BBC3-03          ---IKFGVGSARACPCQVPRASSA--TWVPCQICGPQPSLLLAEQHLESP
F7CM09_BMF-02           ------------MEPSRCVEELEDDVFQ-----------------PEDGE
F7GVS7_BAD-04           MEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKVSAGPPPRP
A0A1D5R1E4_HRK-01       ----MCPCPLHRGRGPPAVCACSAGRLGLR---------------SSAA-
F7GVS7_BAD-02           ----MFQIPEFEPSEQEDSSSAERGLGPSP---------------AGDRP
F7GVS7_BAD-03           ----MFQIPEFEPSEQEDSSSAERGLGPSP---------------AGDRP
F7GVS7_BAD-01           ----MFQIPEFEPSEQEDSSSAERGLGPSP---------------AGDRP
F7HHA9_BCL2L11-08       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-04       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-02       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-06       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-01       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-03       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-05       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-07       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
F7HHA9_BCL2L11-09       ----------MAKQPSDVSSECDREGRQLQ---------------PAERP
                                                                          

A0A1D5QGJ8_PMAIP1-      V---------SSSPLVLPRGHEEQVQVARSRV---------CYSTQEIWR
F7FFP6_BBC3-03          V---------PSAPGALAGGPTQAAPGVRGEE---------EQWAREIGA
F7CM09_BMF-02           P------GAQPGSSLSADLFAQSLLDCPLSRL--------QLFPLTHCCG
F7GVS7_BAD-04           PRAGLSLPCPKARPDLMSHDPSPTPSCPFLAP------------------
A0A1D5R1E4_HRK-01       -------QLTAARLKALGDELHQRTMWRR---------------------
F7GVS7_BAD-02           SDSGKHHRQAPGLLWDASHQQEQPTSSSHHGG---------------TSS
F7GVS7_BAD-03           SDSGKHHRQAPGLLWDASHQQEQPTSSSHHGG--------RAWYSPSWES
F7GVS7_BAD-01           SDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGTE
F7HHA9_BCL2L11-08       P------QLRPGAPTSLQTEPQ----------------------------
F7HHA9_BCL2L11-04       P------QLRPGAPTSLQTEPQGNPEGNHGGE------------GDSCPH
F7HHA9_BCL2L11-02       P------QLRPGAPTSLQTEPQGNPEGNHGGE------------GDSCPH
F7HHA9_BCL2L11-06       P------QLRPGAPTSLQTEPQGNPEGNHGGE------------GDSCPH
F7HHA9_BCL2L11-01       P------QLRPGAPTSLQTEPQGNPEGNHGGE------------GDSCPH
F7HHA9_BCL2L11-03       P------QLRPGAPTSLQTEPQGNPEGNHGGE------------GDSCPH
F7HHA9_BCL2L11-05       P------QLRPGAPTSLQTEPQ----------------------------
F7HHA9_BCL2L11-07       P------QLRPGAPTSLQTEPQ----------------------------
F7HHA9_BCL2L11-09       P------QLRPGAPTSLQTEPQ----------------------------
                                   .                                      

A0A1D5QGJ8_PMAIP1-      QTELPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQ--FEER
F7FFP6_BBC3-03          QLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPE
F7CM09_BMF-02           PGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLP
F7GVS7_BAD-04           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
F7GVS7_BAD-02           PEERGHSDADAAKLQLDASLPVLVGSELGQGKLRTLPVTFA------PRP
F7GVS7_BAD-03           EDSENPSARMLAEASARMSAPATDSEAQHAENVKLKA-------LGLWRP
F7GVS7_BAD-01           EDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRP
F7HHA9_BCL2L11-08       -------------------------------VSLCCPSWSALVLSWLTAT
F7HHA9_BCL2L11-04       GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
F7HHA9_BCL2L11-02       GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
F7HHA9_BCL2L11-06       GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
F7HHA9_BCL2L11-01       GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
F7HHA9_BCL2L11-03       GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
F7HHA9_BCL2L11-05       --------------------------------------------ASRRQA
F7HHA9_BCL2L11-07       --------------------------------------------DRSPAP
F7HHA9_BCL2L11-09       --------------------------------------------DRSPAP
                                                                          

A0A1D5QGJ8_PMAIP1-      LHCN----------------------------------------------
F7FFP6_BBC3-03          MEPN----------------------------------------------
F7CM09_BMF-02           ASFP-----AVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQH
F7GVS7_BAD-04           --------------------------------------------------
A0A1D5R1E4_HRK-01       ---------RARSRRAPASGALPTYWPWLCAAAQVAALAAWLLGRRNL--
F7GVS7_BAD-02           ETPP-----ALTVLVGHLGYGRKCFPQALCKRGSVLPLSVGGLTQIPFRC
F7GVS7_BAD-03           GVAT-----APTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASS
F7GVS7_BAD-01           --KS-----AGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-------
F7HHA9_BCL2L11-08       SNSQ----VQAVLLPQPPK-------------------------------
F7HHA9_BCL2L11-04       MSCD-----KSTQTPSPPCQAFNHYLSAM---------ASRRQAEPADMR
F7HHA9_BCL2L11-02       MSCD-----KSTQTPSPPCQAFNHYLSAM---------ASRRQAEPADMR
F7HHA9_BCL2L11-06       MSCD-----KSTQTPSPPCQAFNHYLSAM---------ANWD--------
F7HHA9_BCL2L11-01       MSCD-----KSTQTPSPPCQAFNHYLSAM---------GIFE--------
F7HHA9_BCL2L11-03       MSCD-----KSTQTPSPPCQAFNHYLSAM---------VREIEEVVV---
F7HHA9_BCL2L11-05       EPADMRPEIRIAQELRRIGDEFNAYYARR-----------LAELLASST-
F7HHA9_BCL2L11-07       MSCD-----KSTQTPSPPCQAFNHYLSAMDEATGSSLGIALHREVQWPLE
F7HHA9_BCL2L11-09       MSCD-----KSTQTPSPPCQAFNHYLSAM---------VVILEDIGDSSL
                                                                          

A0A1D5QGJ8_PMAIP1-      --------------------------------
F7FFP6_BBC3-03          --------------------------------
F7CM09_BMF-02           QQNRNRVWWQILLFLHNLALNGEQNRNGAGPR
F7GVS7_BAD-04           --------------------------------
A0A1D5R1E4_HRK-01       --------------------------------
F7GVS7_BAD-02           M-------------------------------
F7GVS7_BAD-03           GG------------------------------
F7GVS7_BAD-01           --------------------------------
F7HHA9_BCL2L11-08       --------------------------------
F7HHA9_BCL2L11-04       PEIRIAQELRRIGDEFNAYYARRLEK------
F7HHA9_BCL2L11-02       PEIRIAQELRRIGDEFNAYYARRMSLPPD---
F7HHA9_BCL2L11-06       --------------------------------
F7HHA9_BCL2L11-01       --------------------------------
F7HHA9_BCL2L11-03       --------------------------------
F7HHA9_BCL2L11-05       --------------------------------
F7HHA9_BCL2L11-07       WLA-----------------------------
F7HHA9_BCL2L11-09       WFGFIFTGLDLYGHHHSQDTEQLNHKDFS---
                                                        

© 1998-2019