Dataset for protein Bmf of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7CM09_BMF-01      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
F7CM09_BMF-02      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
F7CM09_BMF-03      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
                   ************************************************************

F7CM09_BMF-01      RPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
F7CM09_BMF-02      RPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
F7CM09_BMF-03      RPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
                   ************************************************************

F7CM09_BMF-01      PEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEQNRNG
F7CM09_BMF-02      PEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEQNRNG
F7CM09_BMF-03      PEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEQNRNG
                   ************************************************************

F7CM09_BMF-01      AGPRPLTWNGAVVKPC
F7CM09_BMF-02      AGPR------------
F7CM09_BMF-03      AGPR------------
                   ****            

© 1998-2019