Dataset for protein Bim of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7HHA9_BCL2L11-08      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
F7HHA9_BCL2L11-04      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F7HHA9_BCL2L11-02      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F7HHA9_BCL2L11-06      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F7HHA9_BCL2L11-01      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F7HHA9_BCL2L11-03      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F7HHA9_BCL2L11-05      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
F7HHA9_BCL2L11-07      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
F7HHA9_BCL2L11-09      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                       *****************************************         

F7HHA9_BCL2L11-08      --------------------------------------VSLCCPSWSALV
F7HHA9_BCL2L11-04      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
F7HHA9_BCL2L11-02      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
F7HHA9_BCL2L11-06      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
F7HHA9_BCL2L11-01      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
F7HHA9_BCL2L11-03      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
F7HHA9_BCL2L11-05      --------------------------------------------------
F7HHA9_BCL2L11-07      --------------------------------------------------
F7HHA9_BCL2L11-09      --------------------------------------------------
                                                                         

F7HHA9_BCL2L11-08      LSWLTATSNSQ----VQAVLLPQPPK------------------------
F7HHA9_BCL2L11-04      TDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAM---------ASRRQ
F7HHA9_BCL2L11-02      TDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAM---------ASRRQ
F7HHA9_BCL2L11-06      TDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAM---------ANWD-
F7HHA9_BCL2L11-01      TDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAM---------GIFE-
F7HHA9_BCL2L11-03      TDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAM---------VREIE
F7HHA9_BCL2L11-05      -ASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARR-----------LAE
F7HHA9_BCL2L11-07      -DRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMDEATGSSLGIALHR
F7HHA9_BCL2L11-09      -DRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAM---------VVILE
                             .  .:     . .                               

F7HHA9_BCL2L11-08      ------------------------------------
F7HHA9_BCL2L11-04      AEPADMRPEIRIAQELRRIGDEFNAYYARRLEK---
F7HHA9_BCL2L11-02      AEPADMRPEIRIAQELRRIGDEFNAYYARRMSLPPD
F7HHA9_BCL2L11-06      ------------------------------------
F7HHA9_BCL2L11-01      ------------------------------------
F7HHA9_BCL2L11-03      EVVV--------------------------------
F7HHA9_BCL2L11-05      LLASST------------------------------
F7HHA9_BCL2L11-07      EVQWPLEWLA--------------------------
F7HHA9_BCL2L11-09      DIGDSSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS
                                                           

© 1998-2019