Dataset for protein Bim of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7HHA9_BCL2L11-08      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
F7HHA9_BCL2L11-05      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
F7HHA9_BCL2L11-04      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F7HHA9_BCL2L11-02      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F7HHA9_BCL2L11-03      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F7HHA9_BCL2L11-01      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F7HHA9_BCL2L11-06      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F7HHA9_BCL2L11-07      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
F7HHA9_BCL2L11-09      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                       *****************************************         

F7HHA9_BCL2L11-08      --------------------------------------------------
F7HHA9_BCL2L11-05      --------------------------------------------------
F7HHA9_BCL2L11-04      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
F7HHA9_BCL2L11-02      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
F7HHA9_BCL2L11-03      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
F7HHA9_BCL2L11-01      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
F7HHA9_BCL2L11-06      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
F7HHA9_BCL2L11-07      --------------------------------------------------
F7HHA9_BCL2L11-09      --------------------------------------------------
                                                                         

F7HHA9_BCL2L11-08      ----------------------------------------VSLCCPSWSA
F7HHA9_BCL2L11-05      ----------------------------------------ASRRQAEPAD
F7HHA9_BCL2L11-04      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM---------ASRRQAEPAD
F7HHA9_BCL2L11-02      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM---------ASRRQAEPAD
F7HHA9_BCL2L11-03      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM---------VREIEEVVV-
F7HHA9_BCL2L11-01      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM---------GIFE------
F7HHA9_BCL2L11-06      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM---------ANWD------
F7HHA9_BCL2L11-07      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLGIALHREVQWP
F7HHA9_BCL2L11-09      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM---------VVILEDIGDS
                                                                         

F7HHA9_BCL2L11-08      LVLSWLTATSNSQV----------QAVLLPQPPK
F7HHA9_BCL2L11-05      MRPEIRIAQELRRIGDEFNAYYARRLAELLASST
F7HHA9_BCL2L11-04      MRPEIRIAQELRRIGDEFNAYYARRLEK------
F7HHA9_BCL2L11-02      MRPEIRIAQELRRIGDEFNAYYARRMSLPPD---
F7HHA9_BCL2L11-03      ----------------------------------
F7HHA9_BCL2L11-01      ----------------------------------
F7HHA9_BCL2L11-06      ----------------------------------
F7HHA9_BCL2L11-07      LEWLA-----------------------------
F7HHA9_BCL2L11-09      SLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS---
                                                         

© 1998-2018