Dataset for protein Bad of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7GVS7_BAD-04      ------------------------------------------------------------
F7GVS7_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSH
F7GVS7_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSH
F7GVS7_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSH
                                                                               

F7GVS7_BAD-04      ----------------------------MEEEPSPFRGRSRSAPPNLWAAQRYGRELRRM
F7GVS7_BAD-01      HGGA---GAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRM
F7GVS7_BAD-02      HGGT---SSPEERGHSDADAAKLQLDASLPVLVGSELGQG---------------KLRTL
F7GVS7_BAD-03      HGGRAWYSPSWESEDSENPSARMLAEASARMSAPATDSEAQHAE---------NVKLKAL
                                                     .  . .               :*. :

F7GVS7_BAD-04      SDEFVDSFKVSAGPPPRPPRAGLSLPCPKA------------RPDLMSHDPSPTPSCPFL
F7GVS7_BAD-01      SDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ----------
F7GVS7_BAD-02      PVTFAPRPETPPALTVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQIPFR
F7GVS7_BAD-03      GL-WRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG-------
                      :       .                              . .  . .          

F7GVS7_BAD-04      AP
F7GVS7_BAD-01      --
F7GVS7_BAD-02      CM
F7GVS7_BAD-03      --
                     

© 1998-2018