Dataset for protein classical BH3-containing proteins of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5VPX2_PMAIP1-      -------------------------------------------------M
A0A2K5VW94_BIK-01       MSGVRPISRDTLMETLLYEQLLEPLTME----------------VLGVTD
A0A2K5VCD8_BAD-01       MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
A0A2K5VCD8_BAD-02       MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
A0A2K5VCD8_BAD-03       MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
G7PAW6_BMF-01           ----------------------------MEPSRCVE------------EL
A0A2K5VPX2_PMAIP1-      -------------------MPGKKARKNAQPSPTRAQAGQAGTAGTARDQ
A0A2K5V8J3_BBC3-03      -------------------IKFGVGSARACPCQVPRASSATWVPCQICGP
G7PAW6_BMF-02           ----------------------------MEPSRCVE------------EL
Q2PG01_BAD-01           --------------------------MEEEPSPFRGRSRSAPPNLWAAQR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSS----------ECDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSS----------ECDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSS----------ECDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSS----------ECDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSS----------ECDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSS----------ECDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSS----------ECDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSS----------ECDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSS----------ECDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSS----------ECDR
                                                                          

A0A2K5VPX2_PMAIP1-      PGKKARKNAQPSPTRAQAELEVECATQLRRFGD-----------------
A0A2K5VW94_BIK-01       PEEDLDPMEDF------NPLECMEDSDMLALRLACIGDEMDVSLRAPRLA
A0A2K5VCD8_BAD-01       QQEQPTSSSHHGGA---GAVETRSRHSSYPAGT-----EEDEGMEEEPSP
A0A2K5VCD8_BAD-02       QQEQPTSSSHHGGT---SSPEERGHSDADAAKL-----QLDASLPVLVGS
A0A2K5VCD8_BAD-03       QQEQPTSSSHHGGRAWYSPSWESEDSENPSARM-----LAEASARMSAPA
G7PAW6_BMF-01           EDDVFQPEDGEPGSQPGSSLSADLFAQSLLD-------------------
A0A2K5VPX2_PMAIP1-      AGFGIGMQLHYTRGKKLVSSSPLVLPRGHEEQV-----------QVARSR
A0A2K5V8J3_BBC3-03      QPSLLLAEQHLESPVPSAPGALAGGPTQAAPGV-----------RGEEEQ
G7PAW6_BMF-02           EDDVFQPEDGEPGSQPGSSLSADLFAQSLLD-------------------
Q2PG01_BAD-01           YGRELR------RMSDEFVDSFKGLPR-----------------------
A0A2K5X2I7_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQ-----------------------
A0A2K5X2I7_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQ-----------------------
A0A2K5X2I7_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQ-----------------------
A0A2K5X2I7_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQ-----------------------
A0A2K5X2I7_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGN-----------HGGEGD
A0A2K5X2I7_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGN-----------HGGEGD
A0A2K5X2I7_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGN-----------HGGEGD
A0A2K5X2I7_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGN-----------HGGEGD
A0A2K5X2I7_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGN-----------HGGEGD
A0A2K5X2I7_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGN-----------HGGEGD
                                                                          

A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K5VW94_BIK-01       QLSEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTL-----RENIMRFWR
A0A2K5VCD8_BAD-01       FRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQ
A0A2K5VCD8_BAD-02       ELGQG---------------KLRTLPVTFAPRPETPPALTVLVGHLGYGR
A0A2K5VCD8_BAD-03       TDSEAQHAE---------NVKLKALGL-WRPGVATAPTPRGRRRTKGWRR
G7PAW6_BMF-01           --------------------CPLSRLQLFPLTHCCGPGLRPTSQEDKATQ
A0A2K5VPX2_PMAIP1-      VC-----------------------------------------------Y
A0A2K5V8J3_BBC3-03      WAREIGAQLRRMADDLNAQYERRRQE------------------------
G7PAW6_BMF-02           --------------------CPLSRLQLFPLTHCCGPGLRPTSQEDKATQ
Q2PG01_BAD-01           --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      ------------------------------------------------DR
A0A2K5X2I7_BCL2L11      ------------------------------------------------DR
A0A2K5X2I7_BCL2L11      ------------------------------------------------DR
A0A2K5X2I7_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
A0A2K5X2I7_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
A0A2K5X2I7_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
A0A2K5X2I7_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
A0A2K5X2I7_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
A0A2K5X2I7_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
                                                                          

A0A2K5VPX2_PMAIP1-      -----------------KLNFRQKLLNLIAKLFCSGT-------------
A0A2K5VW94_BIK-01       SPNPRSWVS--------REQVLLVLLLLLALLLALLSGGLHLLLK-----
A0A2K5VCD8_BAD-01       SSSWTRVFQSWWDRNLGRGSS-----------APSQ--------------
A0A2K5VCD8_BAD-02       KCFPQALCK--------RGSV-----------LPLSVGGLTQIPFRCM--
A0A2K5VCD8_BAD-03       SPAPFGAARAPRPPTSGQHSV-----------MAASSGG-----------
G7PAW6_BMF-01           TLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWR
A0A2K5VPX2_PMAIP1-      STQEIWRQTELPAETSESDSQTLLLRNLTASKTCIRGLQ-----------
A0A2K5V8J3_BBC3-03      -------EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN--------
G7PAW6_BMF-02           TLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPP
Q2PG01_BAD-01           -PKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------------
A0A2K5X2I7_BCL2L11      ----------------------------ASRRQAEPADM-----------
A0A2K5X2I7_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAM----DEATGSS-----------
A0A2K5X2I7_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDSS-----------
A0A2K5X2I7_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM-----------
A0A2K5X2I7_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV-------------
A0A2K5X2I7_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD------------------
A0A2K5X2I7_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE------------------
A0A2K5X2I7_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM-----------
A0A2K5X2I7_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM-----------
A0A2K5X2I7_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM-----------
                                                                          

A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------------------
G7PAW6_BMF-01           REQERGGP------------------------------------------
A0A2K5VPX2_PMAIP1-      ------KRLFLRRCTLHQFEERLHCNW-----------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
G7PAW6_BMF-02           EGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLA
Q2PG01_BAD-01           --------------------------------------------------
A0A2K5X2I7_BCL2L11      ------RPEIRIAQELRRIGDEFNAYYARRLAELLASST-----------
A0A2K5X2I7_BCL2L11      ------LGIAL-----------HREVQWPLEWLASS--------------
A0A2K5X2I7_BCL2L11      ------LWFGFIFTGLDLYGHHHSQDTEQLNHKDFS--------------
A0A2K5X2I7_BCL2L11      ------RPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRL
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      ------RPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRL
A0A2K5X2I7_BCL2L11      ------RPEIRIAQELRRIGDEFNAYYARRMSLPPD--------------
A0A2K5X2I7_BCL2L11      ------RPEIRIAQELRRIGDEFNAYYARRLEK-----------------
                                                                          

A0A2K5VPX2_PMAIP1-      -------------
A0A2K5VW94_BIK-01       -------------
A0A2K5VCD8_BAD-01       -------------
A0A2K5VCD8_BAD-02       -------------
A0A2K5VCD8_BAD-03       -------------
G7PAW6_BMF-01           -------------
A0A2K5VPX2_PMAIP1-      -------------
A0A2K5V8J3_BBC3-03      -------------
G7PAW6_BMF-02           LNGEENRNGAGPR
Q2PG01_BAD-01           -------------
A0A2K5X2I7_BCL2L11      -------------
A0A2K5X2I7_BCL2L11      -------------
A0A2K5X2I7_BCL2L11      -------------
A0A2K5X2I7_BCL2L11      LRYIVRLVWRMH-
A0A2K5X2I7_BCL2L11      -------------
A0A2K5X2I7_BCL2L11      -------------
A0A2K5X2I7_BCL2L11      -------------
A0A2K5X2I7_BCL2L11      LRYIVRLVWRMH-
A0A2K5X2I7_BCL2L11      -------------
A0A2K5X2I7_BCL2L11      -------------
                                     

© 1998-2018