Dataset for protein classical BH3-containing proteins of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5VPX2_PMAIP1-      -------------------MPGKKARKNAQPSPTRAQAELEVECATQLRR
G7PAW6_BMF-01           MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLD------CPL
G7PAW6_BMF-02           MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLD------CPL
A0A2K5VPX2_PMAIP1-      -------------------MPGKKARKNAQPSPTRAQAGQAGTAGTARDQ
A0A2K5V8J3_BBC3-03      -------------------IKFGVGSARACPCQVPRASSATWVPCQICGP
A0A2K5VW94_BIK-01       MSGVRPISRDTLMETLLYEQLLEPLTME----------------------
A0A2K5VCD8_BAD-01       MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKH----------HRQ
A0A2K5VCD8_BAD-02       MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKH----------HRQ
A0A2K5VCD8_BAD-03       MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKH----------HRQ
Q2PG01_BAD-01           --------------------------MEEEPSPFRGR----------SRS
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSSE----------CDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSSE----------CDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSSE----------CDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSSE----------CDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSSE----------CDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSSE----------CDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSSE----------CDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSSE----------CDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSSE----------CDR
A0A2K5X2I7_BCL2L11      --------------------------MAKQPSDVSSE----------CDR
                                                                          

A0A2K5VPX2_PMAIP1-      FGDKLNFRQKLLNLIAKLFCSGT---------------------------
G7PAW6_BMF-01           SRLQLFPLTHCCGPGLRPTSQED------KATQTLGPASPSQGVMLPCGV
G7PAW6_BMF-02           SRLQLFPLTHCCGPGLRPTSQED------KATQTLGPASPSQGVMLPCGV
A0A2K5VPX2_PMAIP1-      AGFGIGMQLHY--TRGKKLVSSS------PLVLPRGHEEQVQVARSRVCY
A0A2K5V8J3_BBC3-03      QPSLLLAEQHL--ESPVPSAPGA------LAGGPTQAAPGVRGEEEQWAR
A0A2K5VW94_BIK-01       ----VLGVTDP--EEDLDPMEDF------NPLECMEDSDMLALRLACIGD
A0A2K5VCD8_BAD-01       APGLLWDASHQ--QEQPTSSSHHGGA---GAVETRSRHSSYPAGT-----
A0A2K5VCD8_BAD-02       APGLLWDASHQ--QEQPTSSSHHGGT---SSPEERGHSDADAAKL-----
A0A2K5VCD8_BAD-03       APGLLWDASHQ--QEQPTSSSHHGGRAWYSPSWESEDSENPSARM-----
Q2PG01_BAD-01           APPNLWAAQRY--GRELRRMSDE------FVDSFKGLPRPKSAGTA----
A0A2K5X2I7_BCL2L11      EGRQLQPAERP--PQLRPGAPTS------LQTEPQ---------------
A0A2K5X2I7_BCL2L11      EGRQLQPAERP--PQLRPGAPTS------LQTEPQGNPEGNHGGEGDSCP
A0A2K5X2I7_BCL2L11      EGRQLQPAERP--PQLRPGAPTS------LQTEPQGNPEGNHGGEGDSCP
A0A2K5X2I7_BCL2L11      EGRQLQPAERP--PQLRPGAPTS------LQTEPQGNPEGNHGGEGDSCP
A0A2K5X2I7_BCL2L11      EGRQLQPAERP--PQLRPGAPTS------LQTEPQGNPEGNHGGEGDSCP
A0A2K5X2I7_BCL2L11      EGRQLQPAERP--PQLRPGAPTS------LQTEPQGNPEGNHGGEGDSCP
A0A2K5X2I7_BCL2L11      EGRQLQPAERP--PQLRPGAPTS------LQTEPQGNPEGNHGGEGDSCP
A0A2K5X2I7_BCL2L11      EGRQLQPAERP--PQLRPGAPTS------LQTEPQ---------------
A0A2K5X2I7_BCL2L11      EGRQLQPAERP--PQLRPGAPTS------LQTEPQ---------------
A0A2K5X2I7_BCL2L11      EGRQLQPAERP--PQLRPGAPTS------LQTEPQ---------------
                            :                                             

A0A2K5VPX2_PMAIP1-      --------------------------------------------------
G7PAW6_BMF-01           TEEPQRLFYAPAEPKSRVVADPPL--------------------------
G7PAW6_BMF-02           TEEPQRLFYGNAGYRLPLPASFPA--------------------------
A0A2K5VPX2_PMAIP1-      STQEIWRQTELPAETSESDSQTLLL-------------------------
A0A2K5V8J3_BBC3-03      EIGAQLRRMADDLNAQYERRRQEE--------------------------
A0A2K5VW94_BIK-01       EMDVSLRAPRLAQLSEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTL--
A0A2K5VCD8_BAD-01       EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPR
A0A2K5VCD8_BAD-02       QLDASLPVLVGSELGQG---------------KLRTLPVTFAPRPETPPA
A0A2K5VCD8_BAD-03       LAEASARMSAPATDSEAQHAE---------NVKLKALGL-WRPGVATAPT
Q2PG01_BAD-01           --------------------------------------------------
A0A2K5X2I7_BCL2L11      ---------------------------------------------DRSPA
A0A2K5X2I7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5X2I7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5X2I7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5X2I7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5X2I7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5X2I7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5X2I7_BCL2L11      ---------------------------------------------ASRRQ
A0A2K5X2I7_BCL2L11      ---------------------------------------------DRSPA
A0A2K5X2I7_BCL2L11      ---------------------------------------------DRSPA
                                                                          

A0A2K5VPX2_PMAIP1-      --------------------------------------------------
G7PAW6_BMF-01           ---------------PAQPCFEWRR-------------------------
G7PAW6_BMF-02           ----------VLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQH
A0A2K5VPX2_PMAIP1-      ----------RNLTASKTCIRGLQKRLFLRRCT-----------LHQFEE
A0A2K5V8J3_BBC3-03      ----------QQRHRPSPWRVLYNLIMGLLPLP-----------RGHRAP
A0A2K5VW94_BIK-01       ---RENIMRFWRSPNPRSWVS--------REQVLLVLLLLLALLLALLSG
A0A2K5VCD8_BAD-01       PKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSS-----------APSQ--
A0A2K5VCD8_BAD-02       LTVLVGHLGYGRKCFPQALCK--------RGSV-----------LPLSVG
A0A2K5VCD8_BAD-03       PRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSV-----------MAASSG
Q2PG01_BAD-01           ----------TQMRQSSSWTRVFQSWWDRNLGR-----------GSSAPS
A0A2K5X2I7_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMASR-----------RQAEPA
A0A2K5X2I7_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMVRE-----------IEEVVV
A0A2K5X2I7_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMGIF-----------E-----
A0A2K5X2I7_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMANW-----------D-----
A0A2K5X2I7_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMASR-----------RQAEPA
A0A2K5X2I7_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMASR-----------RQAEPA
A0A2K5X2I7_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMASR-----------RQAEPA
A0A2K5X2I7_BCL2L11      AEPADMRPEIRIAQELRRIGDEFNAYYARR--------------LAELLA
A0A2K5X2I7_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAM---------------DEATG
A0A2K5X2I7_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMVVI-----------LEDIGD
                                                                          

A0A2K5VPX2_PMAIP1-      --------------------------------------------------
G7PAW6_BMF-01           ----------------------EQERGGP---------------------
G7PAW6_BMF-02           QQNRNRVWWQILLFLHNLALNGEENRNGAGPR------------------
A0A2K5VPX2_PMAIP1-      RLHCNW--------------------------------------------
A0A2K5V8J3_BBC3-03      EMEPN---------------------------------------------
A0A2K5VW94_BIK-01       GLHLLLK-------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-02       GLTQIPFRCM----------------------------------------
A0A2K5VCD8_BAD-03       G-------------------------------------------------
Q2PG01_BAD-01           Q-------------------------------------------------
A0A2K5X2I7_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYI
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYI
A0A2K5X2I7_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRMSLPPD------------------
A0A2K5X2I7_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRLEK---------------------
A0A2K5X2I7_BCL2L11      SST-----------------------------------------------
A0A2K5X2I7_BCL2L11      SSLGIAL-----------HREVQWPLEWLASS------------------
A0A2K5X2I7_BCL2L11      SSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS------------------
                                                                          

A0A2K5VPX2_PMAIP1-      --------
G7PAW6_BMF-01           --------
G7PAW6_BMF-02           --------
A0A2K5VPX2_PMAIP1-      --------
A0A2K5V8J3_BBC3-03      --------
A0A2K5VW94_BIK-01       --------
A0A2K5VCD8_BAD-01       --------
A0A2K5VCD8_BAD-02       --------
A0A2K5VCD8_BAD-03       --------
Q2PG01_BAD-01           --------
A0A2K5X2I7_BCL2L11      VRLVWRMH
A0A2K5X2I7_BCL2L11      --------
A0A2K5X2I7_BCL2L11      --------
A0A2K5X2I7_BCL2L11      --------
A0A2K5X2I7_BCL2L11      VRLVWRMH
A0A2K5X2I7_BCL2L11      --------
A0A2K5X2I7_BCL2L11      --------
A0A2K5X2I7_BCL2L11      --------
A0A2K5X2I7_BCL2L11      --------
A0A2K5X2I7_BCL2L11      --------
                                

© 1998-2019