Dataset for protein Bmf of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G7PAW6_BMF-02      MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
G7PAW6_BMF-01      MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
                   ************************************************************

G7PAW6_BMF-02      RPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
G7PAW6_BMF-01      RPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRVVADPPL-----PAQ
                   *************************************. *  .  : *. *         

G7PAW6_BMF-02      PEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEENRNG
G7PAW6_BMF-01      PCFEWRR-----------------------------------------------EQERGG
                   *  :*..                                               *::*.*

G7PAW6_BMF-02      AGPR
G7PAW6_BMF-01      P---
                   .   

© 1998-2018