Dataset for protein Bad of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2PG01_BAD-01          --------------------------------------------------
A0A2K5VCD8_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
A0A2K5VCD8_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
A0A2K5VCD8_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
                                                                         

Q2PG01_BAD-01          --------------------------------------MEEEPSPFRGRS
A0A2K5VCD8_BAD-01      QQEQPTSSSHHGGA---GAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRS
A0A2K5VCD8_BAD-02      QQEQPTSSSHHGGT---SSPEERGHSDADAAKLQLDASLPVLVGSELGQG
A0A2K5VCD8_BAD-03      QQEQPTSSSHHGGRAWYSPSWESEDSENPSARMLAEASARMSAPATDSEA
                                                                   .  . .

Q2PG01_BAD-01          RSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWT
A0A2K5VCD8_BAD-01      RSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWT
A0A2K5VCD8_BAD-02      ---------------KLRTLPVTFAPRPETPPALTVLVGHLGYGRKCFPQ
A0A2K5VCD8_BAD-03      QHAE---------NVKLKALGL-WRPGVATAPTPRGRRRTKGWRRSPAPF
                                      :*. :   :       *            ..    

Q2PG01_BAD-01          RVFQSWWDRNLGRGSSAPSQ------------
A0A2K5VCD8_BAD-01      RVFQSWWDRNLGRGSSAPSQ------------
A0A2K5VCD8_BAD-02      ALCK--------RGSVLPLSVGGLTQIPFRCM
A0A2K5VCD8_BAD-03      GAARAPRPPTSGQHSVMAASSGG---------
                          .        . *  . .            

© 1998-2018