Dataset for protein classical BH3-containing proteins of organism Loxodonta africana

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3T7Z4_BMF-01          MPRAGVFWKQYRTVLSLVHQRPPALAAAAVRSPRLPPLPAELFPSFPIES
G3T2N1_BBC3-01         --------------------------MARARQEGSSPEPVEGLARESPRP
G3SU55_BCL2L11-01      ------------------MAKQPSDVSSECDREGGQLQPAERPPQPPQLR
G3TP47_BAD-01          -----------------GPPENPSPASTHA--QGVRMSGAEHPEKKKGRR
G3T0P7_PMAIP1-01       --------------------------------------------------
G3UH24_HRK-01          --------------------------------------------------
                                                                         

G3T7Z4_BMF-01          GRQAPRVLVTLDPGAEPWRHDPETDTLSWSHPGEMEPSQCVEELEDDVFQ
G3T2N1_BBC3-01         FPLGSLV------------------------PSAVSCGLC----------
G3SU55_BCL2L11-01      --PGAPTSLLTEPQGNPDGEGDSCPQGSPQGPQAP---PA----------
G3TP47_BAD-01          RSSGGLQSMFQIPEFEQSDREDSTPADRGLGPSPEGYWPS----------
G3T0P7_PMAIP1-01       ------------------------------MPGKKARKSA----------
G3UH24_HRK-01          -----------------------------MCPCPLHRGRG----------
                                                      *                  

G3T7Z4_BMF-01          PEEGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRHTSQE
G3T2N1_BBC3-01         -EPGLPRVAGPRLLPGPRTQLFPSPSPVWVSDLSGLQLERGGAEWEDRAP
G3SU55_BCL2L11-01      -SPGPFATRSPLFIFVRRSSLLSRSSSGYFS------FDTDRSPAPMSCD
G3TP47_BAD-01          -GPSDRHRVAPGFLRDSSHQQGQPTSSGHHGGAAAVETRSRHSSYPAGSD
G3T0P7_PMAIP1-01       -QPGPAGTPAGT---QQR--------------------------------
G3UH24_HRK-01          -PPAVCACSAGRLGLRSS--------------------------------
                          .                                              

G3T7Z4_BMF-01          DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPL
G3T2N1_BBC3-01         RPLSGPQPSLSP---------------------AEQHLESPVPTQAAPGV
G3SU55_BCL2L11-01      KSTQTPSPPCQA---------------------INHYLSAMASMRQSQAL
G3TP47_BAD-01          EAEGLEEDPSPF---------------------RGRSLSA----------
G3T0P7_PMAIP1-01       --------------------------------------------------
G3UH24_HRK-01          --------------------------------------------------
                                                                         

G3T7Z4_BMF-01          GEQPPEGQWQHRAEVQIARKLQCIADHFHRLH-----MQRHQQNRNPAWR
G3T2N1_BBC3-01         RG--EDEQW---AR-EIGAQFRRKADDLYALYERSVRQEEQHRHRPSPWR
G3SU55_BCL2L11-01      PADLRPEIW---IA----RELRRIGDEFNAYYPRRAFLNNYQAAEDHPQM
G3TP47_BAD-01          ----PPNLW---AAQRYGRELRRMSDEFQGYFKG---LPRPKSAGTATQM
G3T0P7_PMAIP1-01       ------------DVVECAIQLRRIGDKINFRQKL--------------LN
G3UH24_HRK-01          ------------AAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALP
                                           :.  .* :                      

G3T7Z4_BMF-01          QILQFLHHLAVNGEENRNGAGPR----
G3T2N1_BBC3-01         VLYNLIMGLLPLPRDHGAPEMEPN---
G3SU55_BCL2L11-01      VILRLLRYIVRLVWR------------
G3TP47_BAD-01          RQSPSWTRIIQAWWDRNLGRGSSAPSQ
G3T0P7_PMAIP1-01       VICKLFCSGT-----------------
G3UH24_HRK-01          TYWPWLCAAAQVAALAAWLLRRRNL--
                                                  

© 1998-2018