Dataset for protein classical BH3-containing proteins of organism Latimeria chalumnae

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M3XHJ5_BCL2L11-01      --------------------------------MPTEESLQFDKDQGTSDV
H3ANP3_BAD-03          MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPN
H3ANP3_BAD-04          MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPN
H3ANP3_BAD-01          MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPN
H3ANP3_BAD-02          MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPN
                                                        *:*::  :.* . *:  

M3XHJ5_BCL2L11-01      ISECGHLHPTQRP--------------DQPPFVKQEGCYCIISPLSKVIA
H3ANP3_BAD-03          LQNPGP-HQSHPPSHTGVYGWVKLRKRNNMEILGRPSSESQISDSESLDE
H3ANP3_BAD-04          LQNPGP-HQSHPPSHTVFWGFT-----DNMEILGRPSSESQISDSESLDE
H3ANP3_BAD-01          LQNPGP-HQSHPPSH------T-----DNMEILGRPSSESQISDSESLDE
H3ANP3_BAD-02          LQNPGP-HQSHPPSH------T-----DNMEILGRPSSESQISDSESLDE
                       :.: *  * :: *              ::  :: . .. . **  ..:  

M3XHJ5_BCL2L11-01      LVRWRDRSLLSTLMGGLLLPPSPCPFVTRSPFFIFMRRSLVLSTSSSGYF
H3ANP3_BAD-03          LGPFRTRS-----------RSAPPNFWAARKYGQELRRMSD---------
H3ANP3_BAD-04          LGPFRTRS-----------RSAPPNFWAARKYGQELRRMSD---------
H3ANP3_BAD-01          LGPFRTRS-----------RSAPPNFWAARKYGQELRRMSD---------
H3ANP3_BAD-02          LGPFRTRS-----------RSAPPNFWAARKYGQELRRMSD---------
                       *  :* **            .:*  * :   :   :**            

M3XHJ5_BCL2L11-01      TFDSDIVHSPAPVSVHKATQTPSPSSQLIVHVQHCLAQREQHPETHGKNP
H3ANP3_BAD-03          EFDMSFLGLPRPKSAGAAGEMVDES--WWKKLIRSLKGRGQPRDPPGQ--
H3ANP3_BAD-04          EFDMSFLGLPRPKSAGAAGEMVDES--WWKKLIRSLKGRGQPRDPPGQ--
H3ANP3_BAD-01          EFDMSFLGLPRPKSAGAAGEMVDES--WWKKLIRSLKGRGQPRDPPGQQG
H3ANP3_BAD-02          EFDMSFLGLPRPKSAGAAGEMVDES--WWKKLIRSLKGRGQPRDPPGQQG
                        ** .::  * * *.  * :  . *     :: ..*  * *  :. *:  

M3XHJ5_BCL2L11-01      LNFT---
H3ANP3_BAD-03          -------
H3ANP3_BAD-04          -------
H3ANP3_BAD-01          VSIRGPD
H3ANP3_BAD-02          VSIRGPD
                              

© 1998-2018