Dataset for protein Bad of organism Latimeria chalumnae

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H3ANP3_BAD-03      MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSH
H3ANP3_BAD-04      MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSH
H3ANP3_BAD-01      MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSH
H3ANP3_BAD-02      MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSH
                   ************************************************************

H3ANP3_BAD-03      PPSHTGVYGWVKLRKRNNMEILGRPSSESQISDSESLDELGPFRTRSRSAPPNFWAARKY
H3ANP3_BAD-04      PPSHTVFWGFT-----DNMEILGRPSSESQISDSESLDELGPFRTRSRSAPPNFWAARKY
H3ANP3_BAD-01      PPSH------T-----DNMEILGRPSSESQISDSESLDELGPFRTRSRSAPPNFWAARKY
H3ANP3_BAD-02      PPSH------T-----DNMEILGRPSSESQISDSESLDELGPFRTRSRSAPPNFWAARKY
                   ****      .     :*******************************************

H3ANP3_BAD-03      GQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRDPPGQ-----
H3ANP3_BAD-04      GQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRDPPGQ-----
H3ANP3_BAD-01      GQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRDPPGQQGVSI
H3ANP3_BAD-02      GQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRDPPGQQGVSI
                   *******************************************************     

H3ANP3_BAD-03      ----
H3ANP3_BAD-04      ----
H3ANP3_BAD-01      RGPD
H3ANP3_BAD-02      RGPD
                       

© 1998-2018