Dataset for protein classical BH3-containing proteins of organism Labrus bergylta

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3Q3ESW6_BCL2L11      ------------------MHRPSRPPNRLDGSPTVTESHGTRGDPPQTSR
A0A3Q3MLA0_BAD-01       ---------------------------------------------MTLTA
A0A3Q3MLA0_BAD-02       --------------------------------------------------
A0A3Q3MLA0_BAD-03       MKCNNKCYHFIRLVFVKKQSVICAGYGTVNTFGPAYSRDSTENKISCLGV
                                                                          

A0A3Q3GUU5_BMF-01       --------------MDDEEDDVFEPDPHSWRTYFQEIKCEDRGT--QTPG
A0A3Q3ESW6_BCL2L11      SDNSGGRNFGRTDSTGGGEPDSPSRCRFKPVSPVDSLGVFQKRSIFHLP-
A0A3Q3MLA0_BAD-01       SDVTMAAKFTISDSESGSEEEVKEEEN-DQSSAVEEPHVPQRHSL-TLPE
A0A3Q3MLA0_BAD-02       ----MAAKFTISDSESGSEEEVKEEEN-DQSSAVEEPHVPQRHSL-TLPE
A0A3Q3MLA0_BAD-03       LDVTMAAKFTISDSESGSEEEVKEEEN-DQSSAVEEPHVPQRHSL-TLPE
                                       .. * :  .    .  : .:.    :. :    * 

A0A3Q3GUU5_BMF-01       PALAPNNGMLPCGVAEEPRPLFYGNAGFRLHFPANFELVGDQEESGQE--
A0A3Q3ESW6_BCL2L11      -RRASSGYF----------SYDGDSLPSSPLSPRPLTADKATQTPSPSGQ
A0A3Q3MLA0_BAD-01       LRLAGTGRI----------RLNSESHAYTVSRDEELQARGEEEAGTPT--
A0A3Q3MLA0_BAD-02       LRLAGTGRI----------RLNSESHAYTVSRDEELQARGEEEAGTPT--
A0A3Q3MLA0_BAD-03       LRLAGTGRI----------RLNSESHAYTVSRDEELQARGEEEAGTPT--
                           * .. :               .          :      :       

A0A3Q3GUU5_BMF-01       ------------------------SELQQIGMEQQQPVAHSVEASIGLKL
A0A3Q3ESW6_BCL2L11      VMQHALQRMTEAHGGGPGTQQQYGHSPSLTSRRQRTAAGDMQAEAIGRDL
A0A3Q3MLA0_BAD-01       ------------------------EGAPFRGRSKSAPPALWAAKKYGRQL
A0A3Q3MLA0_BAD-02       ------------------------EGAPFRGRSKSAPPALWAAKKYGRQL
A0A3Q3MLA0_BAD-03       ------------------------EGAPFRGRSKSAPPALWAAKKYGRQL
                                                      .  :  . .       * .*

A0A3Q3GUU5_BMF-01       QLIGDQF-------------------------------------HREHLQ
A0A3Q3ESW6_BCL2L11      QRIGDDYNRLLLWRMAGRHGR-----------------PEVHPNPQPHIQ
A0A3Q3MLA0_BAD-01       RRMSDEFDILLDKGVRIKGGGGGSRGGCGLVVESVVSQPKSQEFNTQLLQ
A0A3Q3MLA0_BAD-02       RRMSDEFDILLDKGVRIKGGGGGSRGGCGLVVESVVSQPKSQEFNTQLLQ
A0A3Q3MLA0_BAD-03       RRMSDEFDILLDKGEMKKVRSPG---------------PAKQMHHSKSW-
                        . :.*::                                           

A0A3Q3GUU5_BMF-01       LYHRNQRNQGPLWWRLGAALLSLLFDRGFIAGAGRR----
A0A3Q3ESW6_BCL2L11      PEPTMLLCTGLMILLIGWIIYLRGNTNSHDHSQV------
A0A3Q3MLA0_BAD-01       PHVRCVLGS-LNVYKWDYLILIITLHSSL-----------
A0A3Q3MLA0_BAD-02       PHVRCVLGS-LNVYKWDYLILIITLHSSL-----------
A0A3Q3MLA0_BAD-03       ---------------WSYLFSHQETEGENNHHENHTHRNE
                                        .  :                    

© 1998-2019