Dataset for protein Bad of organism Labrus bergylta

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3MLA0_BAD-01      ---------------------------------------------MTLTA
A0A3Q3MLA0_BAD-02      --------------------------------------------------
A0A3Q3MLA0_BAD-03      MKCNNKCYHFIRLVFVKKQSVICAGYGTVNTFGPAYSRDSTENKISCLGV
                                                                         

A0A3Q3MLA0_BAD-01      SDVTMAAKFTISDSESGSEEEVKEEENDQSSAVEEPHVPQRHSLTLPELR
A0A3Q3MLA0_BAD-02      ----MAAKFTISDSESGSEEEVKEEENDQSSAVEEPHVPQRHSLTLPELR
A0A3Q3MLA0_BAD-03      LDVTMAAKFTISDSESGSEEEVKEEENDQSSAVEEPHVPQRHSLTLPELR
                           **********************************************

A0A3Q3MLA0_BAD-01      LAGTGRIRLNSESHAYTVSRDEELQARGEEEAGTPTEGAPFRGRSKSAPP
A0A3Q3MLA0_BAD-02      LAGTGRIRLNSESHAYTVSRDEELQARGEEEAGTPTEGAPFRGRSKSAPP
A0A3Q3MLA0_BAD-03      LAGTGRIRLNSESHAYTVSRDEELQARGEEEAGTPTEGAPFRGRSKSAPP
                       **************************************************

A0A3Q3MLA0_BAD-01      ALWAAKKYGRQLRRMSDEFDILLDKGVRIKGGGGGSRGGCGLVVESVVSQ
A0A3Q3MLA0_BAD-02      ALWAAKKYGRQLRRMSDEFDILLDKGVRIKGGGGGSRGGCGLVVESVVSQ
A0A3Q3MLA0_BAD-03      ALWAAKKYGRQLRRMSDEFDILLDKGEMKKVRSPG---------------
                       **************************   *  . *               

A0A3Q3MLA0_BAD-01      PKSQEFNTQLLQPHVRCVLGSLNVYKWDYLILIITLHSSL----------
A0A3Q3MLA0_BAD-02      PKSQEFNTQLLQPHVRCVLGSLNVYKWDYLILIITLHSSL----------
A0A3Q3MLA0_BAD-03      PAKQMHHSKSW---------------WSYLFSHQETEGENNHHENHTHRN
                       * .* .:::                 *.**:      ..           

A0A3Q3MLA0_BAD-01      -
A0A3Q3MLA0_BAD-02      -
A0A3Q3MLA0_BAD-03      E
                        

© 1998-2019