Dataset for protein classical BH3-containing proteins of organism Kryptolebias marmoratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3B113_BCL2L11      ----------MRSPSRPPNLRDGSTEVKATEGSSGGAPPSAGAARGSAHA
A0A3Q2ZA20_BMF-01       MDDEEDDVFEPDPSCWRTTFREIKCEDRGTQTPGPALVPHSGMLPCG---
A0A3Q3AEL8_BAD-02       -------------MAAKFTISDSESEPSDEVEEGKSKQPAAGPEDGV---
A0A3Q3AEL8_BAD-01       -------------MAAKFTISDSESEPSDEVEEGKSKQPAAGPEDGV---
                                      .   .: : . *       . .  * :*        

A0A3Q3B113_BCL2L11      TRPVRGRAPSAAGGEPESPACSSNPPAGLDVFRSRSIFRFPRRSSSGYFS
A0A3Q2ZA20_BMF-01       --------------------------------VAEEPRPLFYGNAGFRLH
A0A3Q3AEL8_BAD-02       --------------------------------RQRLTLPELRHSKNGRLR
A0A3Q3AEL8_BAD-01       --------------------------------RQRLTLPELRHSKNGRLR
                                                                   . .  : 

A0A3Q3B113_BCL2L11      FEGDSLPSSPLSPKPVTAEKATQTPSPTGQVMNHALQRMAVEQGGGPGTH
A0A3Q2ZA20_BMF-01       F------PARFELIRDLEARQQDREEEPN---------------------
A0A3Q3AEL8_BAD-02       VNSESLSSTSSRGEEELPARADDEPGTPTE--------------GYPFRG
A0A3Q3AEL8_BAD-01       VNSESLSSTSSRGEEELPARADDEPGTPTE--------------GYPFRG
                        .      .:          .  :    .                      

A0A3Q3B113_BCL2L11      RLHGSSPNPSGTQARNAAGDMEAESFGRHLRTIGDEYNRLLLLRRMAGRP
A0A3Q2ZA20_BMF-01       RMERLPRQLPVARSLEVC-------IGQKLQLIGDQFHREHLQQYH----
A0A3Q3AEL8_BAD-02       RSKSAPPALWAAKKY-----------GRQLRRMSDEFDSLLDKGEM----
A0A3Q3AEL8_BAD-01       RSKSAPPALWAAKKY-----------GRQLRRMSDEFDSLLDKGEM----
                        *    .     :.             *.:*. :.*::             

A0A3Q3B113_BCL2L11      RRNIVPLNLLPHIHQEPVAMLCVSLLLLLIGRLMYLQGCTNSQNNSQV--
A0A3Q2ZA20_BMF-01       -RNQRNQGPL--------WWRLTAALLSLLFDRGFIAGGGGAGRR-----
A0A3Q3AEL8_BAD-02       -RKVKSAGTTKQIHHSRSWW-------NYLFSHQETDGESSHHEKPTHRT
A0A3Q3AEL8_BAD-01       -RKVKSAGTTKQIHHSRSWW-------NYLFSHQETDGESSHHEKPTHRT
                         *:    .                     :       *  .   .     

A0A3Q3B113_BCL2L11      -
A0A3Q2ZA20_BMF-01       -
A0A3Q3AEL8_BAD-02       E
A0A3Q3AEL8_BAD-01       E
                         

© 1998-2019