Dataset for protein Bad of organism Kryptolebias marmoratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3AEL8_BAD-02      MAAKFTISDSESEPSDEVEEGKSKQPAAGPEDGVRQRLTLPELRHSKNGR
A0A3Q3AEL8_BAD-01      MAAKFTISDSESEPSDEVEEGKSKQPAAGPEDGVRQRLTLPELRHSKNGR
                       **************************************************

A0A3Q3AEL8_BAD-02      LRVNSESLSSTSSRGEEELPARADDEPGTPTEGYPFRGRSKSAPPALWAA
A0A3Q3AEL8_BAD-01      LRVNSESLSSTSSRGEEELPARADDEPGTPTEGYPFRGRSKSAPPALWAA
                       **************************************************

A0A3Q3AEL8_BAD-02      KKYGRQLRRMSDEFDSLLDKGEMRKVKSAGTTKQIHHSRSWWNYLFSHQE
A0A3Q3AEL8_BAD-01      KKYGRQLRRMSDEFDSLLDKGEMRKVKSAGTTKQIHHSRSWWNYLFSHQE
                       **************************************************

A0A3Q3AEL8_BAD-02      TDGESSHHEKPTHRTE
A0A3Q3AEL8_BAD-01      TDGESSHHEKPTHRTE
                       ****************

© 1998-2019