Dataset for protein classical BH3-containing proteins of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3LVX0_BIK-01           --------------------------------------------------
I3MDS9_BMF-01           MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLPGSGVSLPQVFIT
I3MDS9_BMF-02           --------------------------------------------------
I3MBM5_BAD-01           --------------------------------------------------
I3MBM5_BAD-02           --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
                                                                          

I3LVX0_BIK-01           --------------------------------------------------
I3MDS9_BMF-01           LDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQP
I3MDS9_BMF-02           -------------------VFPEEMEPPQCVEELEDDVFQPEDGEPGTQP
I3MBM5_BAD-01           ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
I3MBM5_BAD-02           ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
A0A287DFJ0_BCL2L11      -----------------MAKQPSDVSSECDREG---GQLQPAERPPQLRP
A0A287DFJ0_BCL2L11      -----------------MAKQPSDVSSECDREG---GQLQPAERPPQLRP
                                                                          

I3LVX0_BIK-01           --------------------------------------------------
I3MDS9_BMF-01           GSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT------
I3MDS9_BMF-02           GSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT------
I3MBM5_BAD-01           A-------WTQSMFQIPEFEPSEQEDSSSAEGGLGPSPAGDRPG------
I3MBM5_BAD-02           A-------WTQSMFQIPEFEPSEQEDSSSAEGGLGPSPAGDRPG------
A0A287DFJ0_BCL2L11      G-------APTSLQTEPQ--------------------------------
A0A287DFJ0_BCL2L11      G-------APTSLQTEPQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRS
                                                                          

I3LVX0_BIK-01           -------------------MVQGSHQVALRLACIGDEMDLCFQDLQLAQL
I3MDS9_BMF-01           ------QTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLP----ASF
I3MDS9_BMF-02           ------QTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLP----ASF
I3MBM5_BAD-01           -----------CGLAPGLPRDTGHQQWQATSSSNHGGAGATETRSRHSSY
I3MBM5_BAD-02           -----------CGLAPGLPRDTGHQQWQATSSSNHGGAGATETRSRHSSY
A0A287DFJ0_BCL2L11      ------------------------DRSPAPMSCDKSTQTPSPPCQAFNHY
A0A287DFJ0_BCL2L11      PLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHY
                                                                          

I3LVX0_BIK-01           PGMAMHSLALSYSQARVTG-----------------VLRSLAQGLASLRE
I3MDS9_BMF-01           PAGLPLGEQPPEGQWQHR-------AEVQIAR----KLQCIADQFHRLH-
I3MDS9_BMF-02           PAGLPLGEQPPEGQWQHR-------AEVQIAR----KLQCIADQFHRLH-
I3MBM5_BAD-01           PADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-
I3MBM5_BAD-02           PADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-
A0A287DFJ0_BCL2L11      LSAMASMRESQAEPADMR-------PEIWIAQ----ELRRIGDEFNLYYP
A0A287DFJ0_BCL2L11      LSAMASMRESQAEPADMR-------PEIWIAQ----ELRRIGDEFNLYYP
                         .                                   *. :.: :     

I3LVX0_BIK-01           NMWFWRPAAPSTRVPPARACRELLPVLLLLGLLLSRALYLRLQ----
I3MDS9_BMF-01           -------MQQHQQ----NRNRVWWQILLFLHNLALNGDENRDRAGPR
I3MDS9_BMF-02           -------MQQHQQ----NRNRVWWQILLFLHNLALNGDENRDRAGPR
I3MBM5_BAD-01           -KGLPRPRSAGTA----SQMRQSSSWTRFIQSWWDRNLGRRGSAPSQ
I3MBM5_BAD-02           -K------------------------VTFSQSPFLRA----------
A0A287DFJ0_BCL2L11      RRVFFNNYQPEDR----PQMVILRLLRCIIRLVWRMH----------
A0A287DFJ0_BCL2L11      RRVFFNNYQPEDR----PQMVILRLLRCIIRLVWRMH----------
                                                    :                  

© 1998-2018