Dataset for protein classical BH3-containing proteins of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3LVX0_BIK-01           --------------------------------------------------
I3MDS9_BMF-01           MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLPGSGVSLPQVFIT
I3MDS9_BMF-02           --------------------------------------------------
I3MBM5_BAD-02           --------------------------------------------------
I3MBM5_BAD-01           --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
                                                                          

I3LVX0_BIK-01           -----------------MVQGSHQVALRLACIG-----------------
I3MDS9_BMF-01           LDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQP
I3MDS9_BMF-02           -------------------VFPEEMEPPQCVEELEDDVFQPEDGEPGTQP
I3MBM5_BAD-02           ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
I3MBM5_BAD-01           ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
A0A287DFJ0_BCL2L11      -----------------MAKQPSDVSSECDREG---GQLQPAERPPQLRP
A0A287DFJ0_BCL2L11      -----------------MAKQPSDVSSECDREG---GQLQPAERPPQLRP
                                                                          

I3LVX0_BIK-01           ---------------DEMDLCFQDLQLAQLPGMAMHS-------------
I3MDS9_BMF-01           GSLLSADLFAQ----SQLDCPLSRLQLFPLTHCCGPG-------------
I3MDS9_BMF-02           GSLLSADLFAQ----SQLDCPLSRLQLFPLTHCCGPG-------------
I3MBM5_BAD-02           AWTQSMFQIPEFEPSEQEDSSSAEGGLGPSPAGDRPG-------------
I3MBM5_BAD-01           AWTQSMFQIPEFEPSEQEDSSSAEGGLGPSPAGDRPG-------------
A0A287DFJ0_BCL2L11      GAPTSLQTEPQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A287DFJ0_BCL2L11      GAPTSLQTEPQ---------------------------------------
                                                                          

I3LVX0_BIK-01           --------------------------------------------------
I3MDS9_BMF-01           ----------LRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGN
I3MDS9_BMF-02           ----------LRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGN
I3MBM5_BAD-02           ----CGLAPGLPRDTGHQQWQATSSSNHGGAGATETRSRHS---------
I3MBM5_BAD-01           ----CGLAPGLPRDTGHQQWQATSSSNHGGAGATETRSRHS---------
A0A287DFJ0_BCL2L11      RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN---------
A0A287DFJ0_BCL2L11      -----------------DRSPAPMSCDKSTQTPSPPCQAFN---------
                                                                          

I3LVX0_BIK-01           ----LALSYSQARVTGVLRSLAQGLASLR-------ENMWFWR-------
I3MDS9_BMF-01           AGYRLPLPASFPAGLPLGEQPPEGQWQHR-------AEVQIAR----KLQ
I3MDS9_BMF-02           AGYRLPLPASFPAGLPLGEQPPEGQWQHR-------AEVQIAR----KLQ
I3MBM5_BAD-02           ---------SYPADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELR
I3MBM5_BAD-01           ---------SYPADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELR
A0A287DFJ0_BCL2L11      ---------HYLSAMASMRESQAEPADMR-------PEIWIAQ----ELR
A0A287DFJ0_BCL2L11      ---------HYLSAMASMRESQAEPADMR-------PEIWIAQ----ELR
                                                    *        ::.  .       

I3LVX0_BIK-01           -------------PAAPSTRVPPARACRELLPVLLLLGLLLSRALYLRLQ
I3MDS9_BMF-01           CIADQFHRLH--------MQQHQQNRNRVWWQILLFLHNLALNGDENRDR
I3MDS9_BMF-02           CIADQFHRLH--------MQQHQQNRNRVWWQILLFLHNLALNGDENRDR
I3MBM5_BAD-02           RMSDEFEGSF--K--------------------VTFSQSPFLRA------
I3MBM5_BAD-01           RMSDEFEGSF--KGLPRPRSAGTASQMRQSSSWTRFIQSWWDRNLGRRGS
A0A287DFJ0_BCL2L11      RIGDEFNLYYPRRVFFNNYQPEDRPQMVILRLLRCIIRLVWRMH------
A0A287DFJ0_BCL2L11      RIGDEFNLYYPRRVFFNNYQPEDRPQMVILRLLRCIIRLVWRMH------
                                                           :              

I3LVX0_BIK-01           ----
I3MDS9_BMF-01           AGPR
I3MDS9_BMF-02           AGPR
I3MBM5_BAD-02           ----
I3MBM5_BAD-01           APSQ
A0A287DFJ0_BCL2L11      ----
A0A287DFJ0_BCL2L11      ----
                            

© 1998-2019