Dataset for protein Bad of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3MBM5_BAD-01      MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAWTQSMFQIPEFEPSEQED
I3MBM5_BAD-02      MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAWTQSMFQIPEFEPSEQED
                   ************************************************************

I3MBM5_BAD-01      SSSAEGGLGPSPAGDRPGCGLAPGLPRDTGHQQWQATSSSNHGGAGATETRSRHSSYPAD
I3MBM5_BAD-02      SSSAEGGLGPSPAGDRPGCGLAPGLPRDTGHQQWQATSSSNHGGAGATETRSRHSSYPAD
                   ************************************************************

I3MBM5_BAD-01      TDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPRSAGTASQ
I3MBM5_BAD-02      TDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFK-------------
                   ***********************************************             

I3MBM5_BAD-01      MRQSSSWTRFIQSWWDRNLGRRGSAPSQ
I3MBM5_BAD-02      -------VTFSQSPFLRA----------
                          . * ** : *           

© 1998-2018