Dataset for protein Noxa of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q13794_PMAIP1-01      MPGKKARKNAQPSPARAPA-------------------------------
Q13794_PMAIP1-02      MPGKKARKNAQPSPARAPAGPAGTAGTARDQAGFAIGMQLRFTRGKKLLS
                      *******************                               

Q13794_PMAIP1-01      --------ELEVECATQLRRFGDKLNF-----------------------
Q13794_PMAIP1-02      SSLSSSPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTL
                               *      *:.  *..: :                       

Q13794_PMAIP1-01      ----------------------RQKLLNLISKLFCSGT
Q13794_PMAIP1-02      LLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCN--
                                            * .: :: ..*.*.  

© 1998-2018