Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

44 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q9BXH1_BBC3-03         MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRG
Q9BXH1_BBC3-05         ----------------------------------------MKFGMGSAQA
Q96LC9_BMF-07          MEPSQCVEELEDDVFQPEDGE---------PVTQPGSLLSADLFAQSLLD
Q96LC9_BMF-05          MEPSQCVEELEDDVFQPEDGE---------PVTQPGSLLSADLFAQSLLD
Q96LC9_BMF-06          MEPSQCVEELEDDVFQPEDGE---------PVTQPGSLLSADLFAQSLLD
Q96LC9_BMF-02          MEPSQCVEELEDDVFQPEDGE---------PVTQPGSLLSADLFAQSLLD
Q96LC9_BMF-01          MEPSQCVEELEDDVFQPEDGE---------PVTQPGSLLSADLFAQSLLD
Q96LC9_BMF-04          MEPSQCVEELEDDVFQPEDGE---------PVTQPGSLLSADLFAQSLLD
Q96LC9_BMF-03          MEPSQCVEELEDDVFQPEDGE---------PVTQPGSLLSADLFAQSLLD
Q13323_BIK-01          --------MSEVRPLSRDILM---------E-------------------
Q92934_BAD-03          --------MFQIPEFEPSEQE---------D-------------------
Q92934_BAD-04          --------MFQIPEFEPSEQE---------D-------------------
B4DZQ9_BAD-01          --------MFQIPEFEPSEQE---------D-------------------
Q92934_BAD-01          --------MFQIPEFEPSEQE---------D-------------------
Q92934_BAD-02          --------MFQIPEFEPSEQE---------D-------------------
Q9BXH1_BBC3-04         MKFGMGSAQACPCQVPRAAST---------TWVPC---------------
O00198_HRK-01          ---------MCPCPLHRGRGP---------PAVCA---------------
B4DQK3_BBC3-01         -------------------MA---------PGSAM---------------
Q9BXH1_BBC3-06         ----------------------------------M---------------
Q13794_PMAIP1-02       MPGKKARKNAQPSPARAPAGP---------AGTAG---------------
O43521_BCL2L11-11      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-22      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-08      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-24      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-12      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-21      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-03      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-18      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-16      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-09      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-10      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-20      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-17      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-13      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-07      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-19      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-23      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-06      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-15      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-02      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-05      -----------------MAKQ---------PSDVS---------------
O43521_BCL2L11-25      -----------------MAKQ---------PSDVS---------------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       -----------MPGKKARKNAQP---------SPARA-------------
Q9BXH1_BBC3-03         PGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPT
Q9BXH1_BBC3-05         CPCQVPRAASTTWVPCQICGPQPSLSLAEQHLESPVP-------------
Q96LC9_BMF-07          CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASP-------------
Q96LC9_BMF-05          CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASP-------------
Q96LC9_BMF-06          CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASP-------------
Q96LC9_BMF-02          CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASP-------------
Q96LC9_BMF-01          CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASP-------------
Q96LC9_BMF-04          CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASP-------------
Q96LC9_BMF-03          CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASP-------------
Q13323_BIK-01          -----------TLLYEQLLEPPTME-------------------------
Q92934_BAD-03          -----------SSSAERGLGPSPAGDGPSGSGKHHRQ-------------
Q92934_BAD-04          -----------SSSAERGLGPSPAGDGPSGSGKHHRQ-------------
B4DZQ9_BAD-01          -----------SSSAERGLGPSPAGDGPSGSGKHHRQ-------------
Q92934_BAD-01          -----------SSSAERGLGPSPAGDGPSGSGKHHRQ-------------
Q92934_BAD-02          -----------SSSAERGLGPSPAGDGPSGSGKHHRQ-------------
Q9BXH1_BBC3-04         -----------QICETRGAAAAPPLTLE----GPVQS-------------
O00198_HRK-01          -----------CSAGRLGLRSSAAQ-----------L-------------
B4DQK3_BBC3-01         -----------ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLC
Q9BXH1_BBC3-06         -----------ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLC
Q13794_PMAIP1-02       -----------TARDQAGFAIGMQL-------RFTRG-------------
O43521_BCL2L11-11      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-22      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-08      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-24      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-12      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-21      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-03      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-18      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-16      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-09      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-10      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-20      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-17      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-13      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-07      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-19      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-23      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-06      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-15      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-02      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-05      -----------SECDREGRQLQPAE-------RPPQL-------------
O43521_BCL2L11-25      -----------SECDREGRQLQPAE-------RPPQL-------------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       ------------PAELEVECATQLRRFG----------------------
Q9BXH1_BBC3-03         RRHR--RPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQRPGG
Q9BXH1_BBC3-05         ------SAPGALAGGPTQAAP-----------------------GVRGEE
Q96LC9_BMF-07          ------SQGVMLPCGVTEEPQRLFYAPAE-----PKSCVVADPPLPAQPC
Q96LC9_BMF-05          ------SQGVMLPCGVTEEPQRLFYAPAE-----PKSCVVADPPLPAQPC
Q96LC9_BMF-06          ------SQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPE
Q96LC9_BMF-02          ------SQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPE
Q96LC9_BMF-01          ------SQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPE
Q96LC9_BMF-04          ------SQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPE
Q96LC9_BMF-03          ------SQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPE
Q13323_BIK-01          ----------VLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEM
Q92934_BAD-03          ------APGLLWDASHQQEQPTSSSHHGE---------------GTSSPE
Q92934_BAD-04          ------APGLLWDASHQQEQPTSSSHHGG---------RTSYSPSWESED
B4DZQ9_BAD-01          ------APGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDE
Q92934_BAD-01          ------APGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDE
Q92934_BAD-02          ------APGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDE
Q9BXH1_BBC3-04         ------HHGT--PALTQGPQS-----------------------------
O00198_HRK-01          ------TAAR--LKALGDELH-----------------------------
B4DQK3_BBC3-01         EPGLAAAPAA--PTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGP
Q9BXH1_BBC3-06         EPGLAAAPAA--PTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGP
Q13794_PMAIP1-02       ------KKLL--SSSLSSSPL----------------ALPRGHEEQVQVA
O43521_BCL2L11-11      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-22      ------RPGA--PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
O43521_BCL2L11-08      ------RPGA--PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
O43521_BCL2L11-24      ------RPGA--PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
O43521_BCL2L11-12      ------RPGA--PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
O43521_BCL2L11-21      ------RPGA--PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
O43521_BCL2L11-03      ------RPGA--PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
O43521_BCL2L11-18      ------RPGA--PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
O43521_BCL2L11-16      ------RPGA--PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
O43521_BCL2L11-09      ------RPGA--PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
O43521_BCL2L11-10      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-20      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-17      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-13      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-07      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-19      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-23      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-06      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-15      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-02      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-05      ------RPGA--PTSLQTEPQ-----------------------------
O43521_BCL2L11-25      ------RPGA--PTSLQTEPQ-----------------------------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q9BXH1_BBC3-03         SGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRA----------
Q9BXH1_BBC3-05         EQWAREIGAQLRRMADDLNAQYERRRQE-EQQRHRPSPWR----------
Q96LC9_BMF-07          FEWRREQE------------------------------------------
Q96LC9_BMF-05          FEWRREQE------------------------------------------
Q96LC9_BMF-06          GQWQHQAE---------------------HQQNQNRVWWQ----------
Q96LC9_BMF-02          GQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQ----------
Q96LC9_BMF-01          GQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQ----------
Q96LC9_BMF-04          GQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQ----------
Q96LC9_BMF-03          GQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQ----------
Q13323_BIK-01          DVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFM----------
Q92934_BAD-03          ERGHSNADAAKLQLDASLPVLVGSELGQGK-LRPLPVTFA----------
Q92934_BAD-04          --SENPSAGMLAEASAGMSAPAADSEAQ-H-AENVKLEAL----------
B4DZQ9_BAD-01          GMGEEPSPFRGRSRSAPPNLWAAQRYGR-E-LRRMSDEFV----------
Q92934_BAD-01          GMGEEPSPFRGRSRSAPPNLWAAQRYGR-E-LRRMSDEFV----------
Q92934_BAD-02          GMGEEPSPFRGRSRSAPPNLWAAQRYGR-E-LRRMSDEFV----------
Q9BXH1_BBC3-04         -------------------------------PRDGAQLGA----------
O00198_HRK-01          -------------------------------QRTMWRRRA----------
B4DQK3_BBC3-01         RPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIG
Q9BXH1_BBC3-06         RPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIG
Q13794_PMAIP1-02       GSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTC----------
O43521_BCL2L11-11      ------------------VSLCHPGWSALVRSWLTATSNS----------
O43521_BCL2L11-22      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSC----------
O43521_BCL2L11-08      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSC----------
O43521_BCL2L11-24      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSC----------
O43521_BCL2L11-12      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSC----------
O43521_BCL2L11-21      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSC----------
O43521_BCL2L11-03      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSC----------
O43521_BCL2L11-18      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSC----------
O43521_BCL2L11-16      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSC----------
O43521_BCL2L11-09      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSC----------
O43521_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-20      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-07      -------------------------------DRSPAPMSC----------
O43521_BCL2L11-19      -------------------------------DRSPAPMSC----------
O43521_BCL2L11-23      -------------------------------DRSPAPMSC----------
O43521_BCL2L11-06      -------------------------------DRSPAPMSC----------
O43521_BCL2L11-15      -------------------------------DRSPAPMSC----------
O43521_BCL2L11-02      -------------------------------DRSPAPMSC----------
O43521_BCL2L11-05      -------------------------------DRSPAPMSC----------
O43521_BCL2L11-25      -------------------------------DRSPAPMSC----------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------MRQAEP
Q13794_PMAIP1-01       --------------------------------DKLNFRQKLLNLISKLFC
Q9BXH1_BBC3-03         -----------------AETRGAAAAPPLTLEGPVQSHHGTPALTQGPQS
Q9BXH1_BBC3-05         --------------------------------VLY---NLIMGLLPLPRG
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------ILLFLHNLALNGEENRNG
Q96LC9_BMF-02          --------------------------------ILLFLHNLALNGEENRNG
Q96LC9_BMF-01          --------------------------------ILLFLHNLALNGEENRNG
Q96LC9_BMF-04          --------------------------------ILLFLHNLALNGEENRNG
Q96LC9_BMF-03          --------------------------------ILLFLHNLALNGEENRNG
Q13323_BIK-01          --------------------------------DGFTTLKENIMRFWRSPN
Q92934_BAD-03          ---------------------------------------------PHPET
Q92934_BAD-04          --------------------------------GLW---RSGVATAPTPRG
B4DZQ9_BAD-01          --------------------------------DSF---KKGL---PRPKS
Q92934_BAD-01          --------------------------------DSF---KKGL---PRPKS
Q92934_BAD-02          --------------------------------DSF---KKGL---PRPKS
Q9BXH1_BBC3-04         -----------CTRPVDVRDSGGRPLPPPDTLASAGDFLCTM--------
O00198_HRK-01          ---------------------RSRRAPAPGALPTYWPWLCAAAQVAALAA
B4DQK3_BBC3-01         AQLRRMADDLNAQYERRRQEEQQRHRPSPWR-VLYNLIMGLLPLPRGHRA
Q9BXH1_BBC3-06         AQLRRMADDLNAQYERRRQEEQQRHRPSPWR-VLYNLIMGLLPLPRGHRA
Q13794_PMAIP1-02       -------------------MRGLLQKSFLRR-CTFHQFEERLHCN-----
O43521_BCL2L11-11      -------------------QVQAVLLPQPPK-------------------
O43521_BCL2L11-22      -------------------D-KSTQTPSPPC-QAFNHYLSAMVREIEEVV
O43521_BCL2L11-08      -------------------D-KSTQTPSPPC-QAFNHYLSAMVREIEEVV
O43521_BCL2L11-24      -------------------D-KSTQTPSPPC-QAFNHYLSAMANWD----
O43521_BCL2L11-12      -------------------D-KSTQTPSPPC-QAFNHYLSAMANWD----
O43521_BCL2L11-21      -------------------D-KSTQTPSPPC-QAFNHYLSAMGIFE----
O43521_BCL2L11-03      -------------------D-KSTQTPSPPC-QAFNHYLSAMASMRQAEP
O43521_BCL2L11-18      -------------------D-KSTQTPSPPC-QAFNHYLSAMASMRQAEP
O43521_BCL2L11-16      -------------------D-KSTQTPSPPC-QAFNHYLSAMASMRQAEP
O43521_BCL2L11-09      -------------------D-KSTQTPSPPC-QAFNHYLSAMASMRQAEP
O43521_BCL2L11-10      ------------------------------------------ASMRQAEP
O43521_BCL2L11-20      ------------------------------------------ASMRQAEP
O43521_BCL2L11-17      ------------------------------------------ASMRQAEP
O43521_BCL2L11-13      ------------------------------------------ASMRQAEP
O43521_BCL2L11-07      -------------------D-KSTQTPSPPC-QAFNHYLSAMV-------
O43521_BCL2L11-19      -------------------D-KSTQTPSPPC-QAFNHYLSAMV-------
O43521_BCL2L11-23      -------------------D-KSTQTPSPPC-QAFNHYLSAMD-------
O43521_BCL2L11-06      -------------------D-KSTQTPSPPC-QAFNHYLSAMVVI-----
O43521_BCL2L11-15      -------------------D-KSTQTPSPPC-QAFNHYLSAMVVI-----
O43521_BCL2L11-02      -------------------D-KSTQTPSPPC-QAFNHYLSAMASMRQAEP
O43521_BCL2L11-05      -------------------D-KSTQTPSPPC-QAFNHYLSAMASMRQAEP
O43521_BCL2L11-25      -------------------D-KSTQTPSPPC-QAFNHYLSAMASMRQAEP
                                                                         

Q6JTU4_BCL2L11-01      ADMRPEIWIAQELRRIG-------------DEFNAYYARRLEK-------
Q13794_PMAIP1-01       SGT-----------------------------------------------
Q9BXH1_BBC3-03         PRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM----------
Q9BXH1_BBC3-05         HRAPEMEPN-----------------------------------------
Q96LC9_BMF-07          RGRP----------------------------------------------
Q96LC9_BMF-05          RGRP----------------------------------------------
Q96LC9_BMF-06          AGPR----------------------------------------------
Q96LC9_BMF-02          AGPR----------------------------------------------
Q96LC9_BMF-01          AGPR----------------------------------------------
Q96LC9_BMF-04          AGPR----------------------------------------------
Q96LC9_BMF-03          AGPR----------------------------------------------
Q13323_BIK-01          PGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK----------------
Q92934_BAD-03          PPVPTALGSHLEYGR---KYFPQAYAKRGSVLSPLEGGLTQIPFRCV---
Q92934_BAD-04          RRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG-------------
B4DZQ9_BAD-01          AGTATQMRQSPRRLR-----------------------------------
Q92934_BAD-01          AGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ----------------
Q92934_BAD-02          AGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ----------------
Q9BXH1_BBC3-04         --------------------------------------------------
O00198_HRK-01          WLLGRRNL------------------------------------------
B4DQK3_BBC3-01         PEMEPN--------------------------------------------
Q9BXH1_BBC3-06         PEMEPN--------------------------------------------
Q13794_PMAIP1-02       --------------------------------------------------
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-22      V-------------------------------------------------
O43521_BCL2L11-08      V-------------------------------------------------
O43521_BCL2L11-24      --------------------------------------------------
O43521_BCL2L11-12      --------------------------------------------------
O43521_BCL2L11-21      --------------------------------------------------
O43521_BCL2L11-03      ADMRPEIWIAQELRRIG-------------DEFNAYYARRVFLNNYQAAE
O43521_BCL2L11-18      ADMRPEIWIAQELRRIG-------------DEFNAYYARRLEK-------
O43521_BCL2L11-16      ADMRPEIWIAQELRRIG-------------DEFNAYYARRMPLPPD----
O43521_BCL2L11-09      ADMRPEIWIAQELRRIG-------------DEFNAYYARRMPLPPD----
O43521_BCL2L11-10      ADMRPEIWIAQELRRIG-------------DEFNAYYARRMPLPPD----
O43521_BCL2L11-20      ADMRPEIWIAQELRRIG-------------DEFNAYYARRMPLPPD----
O43521_BCL2L11-17      ADMRPEIWIAQELRRIG-------------DEFNAYYARRLAKLLASST-
O43521_BCL2L11-13      ADMRPEIWIAQELRRIG-------------DEFNAYYARRLAKLLASST-
O43521_BCL2L11-07      ----------------------------------------------REIE
O43521_BCL2L11-19      ----------------------------------------------REIE
O43521_BCL2L11-23      ----------------------------------------------DSAG
O43521_BCL2L11-06      ------------LEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS
O43521_BCL2L11-15      ------------LEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS
O43521_BCL2L11-02      ADMRPEIWIAQELRRIG-------------DEFNAYYARRVFLNNYQAAE
O43521_BCL2L11-05      ADMRPEIWIAQELRRIG-------------DEFNAYYARRLEK-------
O43521_BCL2L11-25      ADMRPEIWIAQELRRIG-------------DEFNAYYARRLEK-------
                                                                         

Q6JTU4_BCL2L11-01      ----------------------
Q13794_PMAIP1-01       ----------------------
Q9BXH1_BBC3-03         ----------------------
Q9BXH1_BBC3-05         ----------------------
Q96LC9_BMF-07          ----------------------
Q96LC9_BMF-05          ----------------------
Q96LC9_BMF-06          ----------------------
Q96LC9_BMF-02          ----------------------
Q96LC9_BMF-01          ----------------------
Q96LC9_BMF-04          ----------------------
Q96LC9_BMF-03          ----------------------
Q13323_BIK-01          ----------------------
Q92934_BAD-03          ----------------------
Q92934_BAD-04          ----------------------
B4DZQ9_BAD-01          ----------------------
Q92934_BAD-01          ----------------------
Q92934_BAD-02          ----------------------
Q9BXH1_BBC3-04         ----------------------
O00198_HRK-01          ----------------------
B4DQK3_BBC3-01         ----------------------
Q9BXH1_BBC3-06         ----------------------
Q13794_PMAIP1-02       ----------------------
O43521_BCL2L11-11      ----------------------
O43521_BCL2L11-22      ----------------------
O43521_BCL2L11-08      ----------------------
O43521_BCL2L11-24      ----------------------
O43521_BCL2L11-12      ----------------------
O43521_BCL2L11-21      ----------------------
O43521_BCL2L11-03      DHPRMVILRLLRYIVRLVWRMH
O43521_BCL2L11-18      ----------------------
O43521_BCL2L11-16      ----------------------
O43521_BCL2L11-09      ----------------------
O43521_BCL2L11-10      ----------------------
O43521_BCL2L11-20      ----------------------
O43521_BCL2L11-17      ----------------------
O43521_BCL2L11-13      ----------------------
O43521_BCL2L11-07      EVVV------------------
O43521_BCL2L11-19      EVVV------------------
O43521_BCL2L11-23      SSLRIALHREVQWPLKWLAKSS
O43521_BCL2L11-06      ----------------------
O43521_BCL2L11-15      ----------------------
O43521_BCL2L11-02      DHPRMVILRLLRYIVRLVWRMH
O43521_BCL2L11-05      ----------------------
O43521_BCL2L11-25      ----------------------
                                             

© 1998-2019