Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

33 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01       -----------------------MRQAEPAD-------------------
Q13794_PMAIP1-01        ---------------MPGKKARKNAQPSPAR-------------------
Q13323_BIK-01           ---MSEVRPLSRDILMETLLYEQLLEPPTME----------------VLG
Q92934_BAD-03           ---MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWD
Q92934_BAD-04           ---MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWD
B4DZQ9_BAD-01           ---MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWD
Q92934_BAD-02           ---MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWD
Q92934_BAD-01           ---MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWD
O00198_HRK-01           MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQ-------------------
B4DQK3_BBC3-01          ----------MAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSA
Q13794_PMAIP1-02        ---------------------MPGKKARKNA-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
A0A0C4DH20_BCL2L11      --------MAKQPSDVSSECDREGRQLQPAE-------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
Q13794_PMAIP1-01        ------APAELE--------------------------------------
Q13323_BIK-01           MTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLS
Q92934_BAD-03           ASHQQEQPTSSSHHGE---------------GTSSPEERGHSNADAAKLQ
Q92934_BAD-04           ASHQQEQPTSSSHHGG---------RTSYSPSWESED--SENPSAGMLAE
B4DZQ9_BAD-01           ASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRS
Q92934_BAD-02           ASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRS
Q92934_BAD-01           ASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRS
O00198_HRK-01           -----LTAARLKALGDELHQRTMWR-------------------------
B4DQK3_BBC3-01          VSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSR
Q13794_PMAIP1-02        ------QPSPARAPAGPAGTAGTARDQAGFAIG-----------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
A0A0C4DH20_BCL2L11      ------RPPQLR-PGAPTSLQTEPQ-------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
Q13794_PMAIP1-01        -----------------------------------------VECATQLRR
Q13323_BIK-01           EVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWV
Q92934_BAD-03           LDASLPVLVGSELGQGK-LRPLPVTFA-------------PHPETPPVPT
Q92934_BAD-04           ASAGMSAPAADSEAQ-H-AENVKLEALGLW---RSGVATAPTPRGRRTTK
B4DZQ9_BAD-01           RSAPPNLWAAQRYGR-E-LRRMSDEFVDSF---KKGL---PRPKSAGTAT
Q92934_BAD-02           RSAPPNLWAAQRYGR-E-LRRMSDEFVDSF---KKGL---PRPKSAGTAT
Q92934_BAD-01           RSAPPNLWAAQRYGR-E-LRRMSDEFVDSF---KKGL---PRPKSAGTAT
O00198_HRK-01           --------------------------------------------RRARSR
B4DQK3_BBC3-01          PRGPRPD----------------------------GPQPSLSLAEQHLES
Q13794_PMAIP1-02        ---------------------MQLRFTRGKKLLSSSLSSSPLALPRGHEE
A0A0C4DH20_BCL2L11      -----------------------------------------------VSL
A0A0C4DH20_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A0C4DH20_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
                                                                          

Q6JTU4_BCL2L11-01       ---------------------------MRPEIWIAQELRRIG--------
Q13794_PMAIP1-01        FGDKLNFRQKLLNLISKLFCSGT---------------------------
Q13323_BIK-01           SCEQVLLALLLLLALLLPLLSGGLHLLLK---------------------
Q92934_BAD-03           ALGSHLEYGR---KYFPQAYAKRGSVLSPLEGGLTQIPFRCV--------
Q92934_BAD-04           GWGRSPAPFGAARARRPPTSGQHSAMAASSGG------------------
B4DZQ9_BAD-01           QMRQSPRRLR----------------------------------------
Q92934_BAD-02           QMRQSSSWTRVFQSWWDRNLGRGSSAPSQ---------------------
Q92934_BAD-01           QMRQSSSWTRVFQSWWDRNLGRGSSAPSQ---------------------
O00198_HRK-01           RAPAPGALPTYWPWLCAAAQVAA---------------------------
B4DQK3_BBC3-01          PVPSAPG---ALAGGPTQAAPGVRGEEEQWAREIGAQLRRMA--------
Q13794_PMAIP1-02        QVQVAGSRVCYSTQEIWRQTELP--AETSESDIQTLLLRNLTASKTCMRG
A0A0C4DH20_BCL2L11      CHPGWSALVRSWLTATSNSQVQAVLLPQPPK-------------------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMDDSAGSSLRIALHREVQWPLKWLAKSS--------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMVREIEEVV--V------------------------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMVREIEEVV--V------------------------
A0A0C4DH20_BCL2L11      ---------------ASMRQAEP--ADMRPEIWIAQELRRIG--------
A0A0C4DH20_BCL2L11      ---------------ASMRQAEP--ADMRPEIWIAQELRRIG--------
A0A0C4DH20_BCL2L11      ---------------ASMRQAEP--ADMRPEIWIAQELRRIG--------
A0A0C4DH20_BCL2L11      ---------------ASMRQAEP--ADMRPEIWIAQELRRIG--------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMVREIEEVV--V------------------------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMVREIEEVV--V------------------------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMANWD-------------------------------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMANWD-------------------------------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMGIFE-------------------------------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWIAQELRRIG--------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWIAQELRRIG--------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWIAQELRRIG--------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWIAQELRRIG--------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMVVI-------------------LEDIGDLSLCFGF
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMVVI-------------------LEDIGDLSLCFGF
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWIAQELRRIG--------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWIAQELRRIG--------
A0A0C4DH20_BCL2L11      PSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWIAQELRRIG--------
                                                                          

Q6JTU4_BCL2L11-01       -----DEFNAYYARRLEK--------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
O00198_HRK-01           -------LAAWLLGRRNL--------------------------------
B4DQK3_BBC3-01          -----DDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEM
Q13794_PMAIP1-02        LLQKSFLRRCTFHQFEERLHCN----------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      -----DEFNAYYARRMPLPPD-----------------------------
A0A0C4DH20_BCL2L11      -----DEFNAYYARRMPLPPD-----------------------------
A0A0C4DH20_BCL2L11      -----DEFNAYYARRLAKLLASST--------------------------
A0A0C4DH20_BCL2L11      -----DEFNAYYARRLAKLLASST--------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      -----DEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH---
A0A0C4DH20_BCL2L11      -----DEFNAYYARRMPLPPD-----------------------------
A0A0C4DH20_BCL2L11      -----DEFNAYYARRMPLPPD-----------------------------
A0A0C4DH20_BCL2L11      -----DEFNAYYARRLEK--------------------------------
A0A0C4DH20_BCL2L11      IFTGLDLYGHHHSQDTEQLNHKDFS-------------------------
A0A0C4DH20_BCL2L11      IFTGLDLYGHHHSQDTEQLNHKDFS-------------------------
A0A0C4DH20_BCL2L11      -----DEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH---
A0A0C4DH20_BCL2L11      -----DEFNAYYARRLEK--------------------------------
A0A0C4DH20_BCL2L11      -----DEFNAYYARRLEK--------------------------------
                                                                          

Q6JTU4_BCL2L11-01       ---
Q13794_PMAIP1-01        ---
Q13323_BIK-01           ---
Q92934_BAD-03           ---
Q92934_BAD-04           ---
B4DZQ9_BAD-01           ---
Q92934_BAD-02           ---
Q92934_BAD-01           ---
O00198_HRK-01           ---
B4DQK3_BBC3-01          EPN
Q13794_PMAIP1-02        ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
A0A0C4DH20_BCL2L11      ---
                           

© 1998-2018