Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

44 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       ------------------------------MPGKKAR-------------
Q9BXH1_BBC3-03         MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGP-------------
Q9BXH1_BBC3-05         -------------------------------------MKFGMGSAQACPC
Q96LC9_BMF-07          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADLFAQSLLDCPL
Q96LC9_BMF-05          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADLFAQSLLDCPL
Q96LC9_BMF-01          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADLFAQSLLDCPL
Q96LC9_BMF-02          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADLFAQSLLDCPL
Q96LC9_BMF-03          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADLFAQSLLDCPL
Q96LC9_BMF-04          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADLFAQSLLDCPL
Q96LC9_BMF-06          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADLFAQSLLDCPL
Q13323_BIK-01          --------MSEVRPLSRDILME----------------------------
Q92934_BAD-03          --------MFQIPEFEPSEQED----------------------------
Q92934_BAD-04          --------MFQIPEFEPSEQED----------------------------
B4DZQ9_BAD-01          --------MFQIPEFEPSEQED----------------------------
Q92934_BAD-01          --------MFQIPEFEPSEQED----------------------------
Q92934_BAD-02          --------MFQIPEFEPSEQED----------------------------
Q9BXH1_BBC3-04         MKFGMGSAQACPCQVPRAASTTWVPCQICETRGAAAAPPL----------
O00198_HRK-01          ---MCPCPLHRGRGPPAVCACS------AGRLGLRSSAAQ----------
B4DQK3_BBC3-01         -------------MAPGSAMAR------ARQEGSSPEPVEGLARDGPRPF
Q9BXH1_BBC3-06         -------------------MAR------ARQEGSSPEPVEGLARDGPRPF
Q13794_PMAIP1-02       ------------------------------MPGKKARKNA----------
O43521_BCL2L11-02      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-08      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-22      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-24      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-12      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-21      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-03      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-18      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-16      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-09      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-11      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-19      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-07      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-23      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-10      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-20      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-17      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-13      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-06      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-15      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-05      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-25      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       ---------------KNAQPSPARAPAELEVECAT---------------
Q9BXH1_BBC3-03         ---------------RTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLR
Q9BXH1_BBC3-05         QVPRAASTTWVPCQICGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAP-
Q96LC9_BMF-07          SRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
Q96LC9_BMF-05          SRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
Q96LC9_BMF-01          SRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
Q96LC9_BMF-02          SRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
Q96LC9_BMF-03          SRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
Q96LC9_BMF-04          SRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
Q96LC9_BMF-06          SRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
Q13323_BIK-01          --------TLLYEQLLEPPTME----------------VLGMTDSEEDLD
Q92934_BAD-03          --------SSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPT
Q92934_BAD-04          --------SSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPT
B4DZQ9_BAD-01          --------SSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPT
Q92934_BAD-01          --------SSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPT
Q92934_BAD-02          --------SSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPT
Q9BXH1_BBC3-04         ------------TLEGPVQSH-HGTP-ALTQGPQSPRDGAQL--------
O00198_HRK-01          --------------LTAARLKALGDELHQRTMWR----------------
B4DQK3_BBC3-01         PLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGS
Q9BXH1_BBC3-06         PLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGS
Q13794_PMAIP1-02       ---------------QPSPARAPAGPAGTAGTARDQAGFAIG--------
O43521_BCL2L11-02      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-08      ---------------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPH
O43521_BCL2L11-22      ---------------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPH
O43521_BCL2L11-24      ---------------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPH
O43521_BCL2L11-12      ---------------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPH
O43521_BCL2L11-21      ---------------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPH
O43521_BCL2L11-03      ---------------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPH
O43521_BCL2L11-18      ---------------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPH
O43521_BCL2L11-16      ---------------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPH
O43521_BCL2L11-09      ---------------RPPQLR-PGAPTSLQTEPQGNPEGNHGGEGDSCPH
O43521_BCL2L11-11      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-19      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-07      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-23      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-10      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-20      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-17      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-13      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-06      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-15      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-05      ---------------RPPQLR-PGAPTSLQTEPQ----------------
O43521_BCL2L11-25      ---------------RPPQLR-PGAPTSLQTEPQ----------------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q9BXH1_BBC3-03         PLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRP
Q9BXH1_BBC3-05         ----------------------GVRGEEEQWAREIGAQLRRMADDLNAQY
Q96LC9_BMF-07          LFYAPAE-----PKSCVVADPPLPAQPCFEWRREQE--------------
Q96LC9_BMF-05          LFYAPAE-----PKSCVVADPPLPAQPCFEWRREQE--------------
Q96LC9_BMF-01          LFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQF
Q96LC9_BMF-02          LFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQF
Q96LC9_BMF-03          LFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQF
Q96LC9_BMF-04          LFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQF
Q96LC9_BMF-06          LFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAE--------------
Q13323_BIK-01          PMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGL
Q92934_BAD-03          SSSHHGE---------------GTSSPEERGHSNADAAKLQLDASLPVLV
Q92934_BAD-04          SSSHHGG---------RTSYSPSWESED--SENPSAGMLAEASAGMSAPA
B4DZQ9_BAD-01          SSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWA
Q92934_BAD-01          SSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWA
Q92934_BAD-02          SSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWA
Q9BXH1_BBC3-04         --------------------------------------------GACTRP
O00198_HRK-01          --------------------------------------------------
B4DQK3_BBC3-01         RWPGGPRSRPRGPRPD----------------------------GPQPSL
Q9BXH1_BBC3-06         RWPGGPRSRPRGPRPD----------------------------GPQPSL
Q13794_PMAIP1-02       ------------------------------MQLRFTRGKKLLSSSLSSSP
O43521_BCL2L11-02      --------------------------------------------DRSPAP
O43521_BCL2L11-08      GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
O43521_BCL2L11-22      GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
O43521_BCL2L11-24      GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
O43521_BCL2L11-12      GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
O43521_BCL2L11-21      GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
O43521_BCL2L11-03      GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
O43521_BCL2L11-18      GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
O43521_BCL2L11-16      GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
O43521_BCL2L11-09      GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-19      --------------------------------------------DRSPAP
O43521_BCL2L11-07      --------------------------------------------DRSPAP
O43521_BCL2L11-23      --------------------------------------------DRSPAP
O43521_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-20      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-06      --------------------------------------------DRSPAP
O43521_BCL2L11-15      --------------------------------------------DRSPAP
O43521_BCL2L11-05      --------------------------------------------DRSPAP
O43521_BCL2L11-25      --------------------------------------------DRSPAP
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       -------------------------------------------QLRRFGD
Q9BXH1_BBC3-03         APGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDR
Q9BXH1_BBC3-05         ERRRQE--------------------------------------EQQRHR
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-01          HRLHVQ-------------------------------------QHQQNQN
Q96LC9_BMF-02          HRLHVQ-------------------------------------QHQQNQN
Q96LC9_BMF-03          HRLHVQ-------------------------------------QHQQNQN
Q96LC9_BMF-04          HRLHVQ-------------------------------------QHQQNQN
Q96LC9_BMF-06          --------------------------------------------HQQNQN
Q13323_BIK-01          AFIYDQ-------------------------------------TEDIRDV
Q92934_BAD-03          GSELGQ-------------------------------------GK-LRPL
Q92934_BAD-04          ADSEAQ--------------------------------------H-AENV
B4DZQ9_BAD-01          AQRYGR--------------------------------------E-LRRM
Q92934_BAD-01          AQRYGR--------------------------------------E-LRRM
Q92934_BAD-02          AQRYGR--------------------------------------E-LRRM
Q9BXH1_BBC3-04         VDVRDS-------------------------------------GGRPLPP
O00198_HRK-01          -RRARS-------------------------------------RRAPAPG
B4DQK3_BBC3-01         SLAEQH-------------------------------------LESPVPS
Q9BXH1_BBC3-06         SLAEQH-------------------------------------LESPVPS
Q13794_PMAIP1-02       LALPRG-------------------------------------HEEQVQV
O43521_BCL2L11-02      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-08      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-22      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-24      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-12      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-21      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-03      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-18      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-16      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-09      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-11      -------------------------------------------VSLCHPG
O43521_BCL2L11-19      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-07      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-23      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-20      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-06      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-15      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-05      MSCDKS-------------------------------------TQTPSPP
O43521_BCL2L11-25      MSCDKS-------------------------------------TQTPSPP
                                                                         

Q6JTU4_BCL2L11-01      ---------------MRQAEPADMRPEIWIAQELRRIG------------
Q13794_PMAIP1-01       KLNFRQKLLNLISKLFCSGT------------------------------
Q9BXH1_BBC3-03         GPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSP
Q9BXH1_BBC3-05         PSPWRVLY---NLIMGLLPLPRGHRAPEMEPN------------------
Q96LC9_BMF-07          -----------------------RGRP-----------------------
Q96LC9_BMF-05          -----------------------RGRP-----------------------
Q96LC9_BMF-01          RVWWQILLFLHNLALNGEENRNGAGPR-----------------------
Q96LC9_BMF-02          RVWWQILLFLHNLALNGEENRNGAGPR-----------------------
Q96LC9_BMF-03          RVWWQILLFLHNLALNGEENRNGAGPR-----------------------
Q96LC9_BMF-04          RVWWQILLFLHNLALNGEENRNGAGPR-----------------------
Q96LC9_BMF-06          RVWWQILLFLHNLALNGEENRNGAGPR-----------------------
Q13323_BIK-01          LRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSG
Q92934_BAD-03          PVTFA-------------PHPETPPVPTALGSHLEYGR---KYFPQAYAK
Q92934_BAD-04          KLEALGLW---RSGVATAPTPRGRRTTKGWGRSPAPFGAARARRPPTSGQ
B4DZQ9_BAD-01          SDEFVDSF---KKGL---PRPKSAGTATQMRQSPRRLR------------
Q92934_BAD-01          SDEFVDSF---KKGL---PRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
Q92934_BAD-02          SDEFVDSF---KKGL---PRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
Q9BXH1_BBC3-04         PDTLASAGDFLCTM------------------------------------
O00198_HRK-01          ALPTYWPWLCAAAQVAALAAWLLGRRNL----------------------
B4DQK3_BBC3-01         APG---ALAGGPTQAAPGVRGEEEQWAREIGAQLRRMA------------
Q9BXH1_BBC3-06         APG---ALAGGPTQAAPGVRGEEEQWAREIGAQLRRMA------------
Q13794_PMAIP1-02       AGSRVCYSTQEIWRQTELPA---------------------------ETS
O43521_BCL2L11-02      CQAFNHYLSAMASMRQAEPA--DMRPEIWIAQELRRIG------------
O43521_BCL2L11-08      CQAFNHYLSAMVREIEEVVV------------------------------
O43521_BCL2L11-22      CQAFNHYLSAMVREIEEVVV------------------------------
O43521_BCL2L11-24      CQAFNHYLSAMANWD-----------------------------------
O43521_BCL2L11-12      CQAFNHYLSAMANWD-----------------------------------
O43521_BCL2L11-21      CQAFNHYLSAMGIFE-----------------------------------
O43521_BCL2L11-03      CQAFNHYLSAMASMRQAEPA--DMRPEIWIAQELRRIG------------
O43521_BCL2L11-18      CQAFNHYLSAMASMRQAEPA--DMRPEIWIAQELRRIG------------
O43521_BCL2L11-16      CQAFNHYLSAMASMRQAEPA--DMRPEIWIAQELRRIG------------
O43521_BCL2L11-09      CQAFNHYLSAMASMRQAEPA--DMRPEIWIAQELRRIG------------
O43521_BCL2L11-11      WSALVRSWLTATSNSQVQAVLLPQPPK-----------------------
O43521_BCL2L11-19      CQAFNHYLSAMVREIEEVVV------------------------------
O43521_BCL2L11-07      CQAFNHYLSAMVREIEEVVV------------------------------
O43521_BCL2L11-23      CQAFNHYLSAMDDSAGSSLRIALHREVQWPLKWLAKSS------------
O43521_BCL2L11-10      -----------ASMRQAEPA--DMRPEIWIAQELRRIG------------
O43521_BCL2L11-20      -----------ASMRQAEPA--DMRPEIWIAQELRRIG------------
O43521_BCL2L11-17      -----------ASMRQAEPA--DMRPEIWIAQELRRIG------------
O43521_BCL2L11-13      -----------ASMRQAEPA--DMRPEIWIAQELRRIG------------
O43521_BCL2L11-06      CQAFNHYLSAMVVI-------------------LEDIGDLSLCFGFIFTG
O43521_BCL2L11-15      CQAFNHYLSAMVVI-------------------LEDIGDLSLCFGFIFTG
O43521_BCL2L11-05      CQAFNHYLSAMASMRQAEPA--DMRPEIWIAQELRRIG------------
O43521_BCL2L11-25      CQAFNHYLSAMASMRQAEPA--DMRPEIWIAQELRRIG------------
                                                                         

Q6JTU4_BCL2L11-01      -DEFNAYYARRLEK-----------------------------------
Q13794_PMAIP1-01       -------------------------------------------------
Q9BXH1_BBC3-03         RDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM----------
Q9BXH1_BBC3-05         -------------------------------------------------
Q96LC9_BMF-07          -------------------------------------------------
Q96LC9_BMF-05          -------------------------------------------------
Q96LC9_BMF-01          -------------------------------------------------
Q96LC9_BMF-02          -------------------------------------------------
Q96LC9_BMF-03          -------------------------------------------------
Q96LC9_BMF-04          -------------------------------------------------
Q96LC9_BMF-06          -------------------------------------------------
Q13323_BIK-01          GLHLLLK------------------------------------------
Q92934_BAD-03          RGSVLSPLEGGLTQIPFRCV-----------------------------
Q92934_BAD-04          HSAMAASSGG---------------------------------------
B4DZQ9_BAD-01          -------------------------------------------------
Q92934_BAD-01          GSSAPSQ------------------------------------------
Q92934_BAD-02          GSSAPSQ------------------------------------------
Q9BXH1_BBC3-04         -------------------------------------------------
O00198_HRK-01          -------------------------------------------------
B4DQK3_BBC3-01         -DDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
Q9BXH1_BBC3-06         -DDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
Q13794_PMAIP1-02       ESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCN------
O43521_BCL2L11-02      -DEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH------
O43521_BCL2L11-08      -------------------------------------------------
O43521_BCL2L11-22      -------------------------------------------------
O43521_BCL2L11-24      -------------------------------------------------
O43521_BCL2L11-12      -------------------------------------------------
O43521_BCL2L11-21      -------------------------------------------------
O43521_BCL2L11-03      -DEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH------
O43521_BCL2L11-18      -DEFNAYYARRLEK-----------------------------------
O43521_BCL2L11-16      -DEFNAYYARRMPLPPD--------------------------------
O43521_BCL2L11-09      -DEFNAYYARRMPLPPD--------------------------------
O43521_BCL2L11-11      -------------------------------------------------
O43521_BCL2L11-19      -------------------------------------------------
O43521_BCL2L11-07      -------------------------------------------------
O43521_BCL2L11-23      -------------------------------------------------
O43521_BCL2L11-10      -DEFNAYYARRMPLPPD--------------------------------
O43521_BCL2L11-20      -DEFNAYYARRMPLPPD--------------------------------
O43521_BCL2L11-17      -DEFNAYYARRLAKLLASST-----------------------------
O43521_BCL2L11-13      -DEFNAYYARRLAKLLASST-----------------------------
O43521_BCL2L11-06      LDLYGHHHSQDTEQLNHKDFS----------------------------
O43521_BCL2L11-15      LDLYGHHHSQDTEQLNHKDFS----------------------------
O43521_BCL2L11-05      -DEFNAYYARRLEK-----------------------------------
O43521_BCL2L11-25      -DEFNAYYARRLEK-----------------------------------
                                                                        

© 1998-2019