Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

44 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01      --------------------------------MRQAEPAD----------
Q13794_PMAIP1-01       ------------------------------MPGKKARKNA----------
Q9BXH1_BBC3-03         MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTP----GGQLPG
O00198_HRK-01          -------------MCPCPLHRGRGPPAVCACSAGRLGLRS----------
Q9BXH1_BBC3-04         MKFGMGSAQACPCQVPRAASTTWVPCQICETRGAAAAPPLTLE-------
B4DQK3_BBC3-01         -------------MAPGSAMAR------ARQEGSSPEPVEGLARDGPRPF
Q9BXH1_BBC3-06         -------------------MAR------ARQEGSSPEPVEGLARDGPRPF
Q13794_PMAIP1-02       ------------------------------MPGKKARKNA----------
O43521_BCL2L11-11      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-03      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-20      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-09      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-21      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-24      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-08      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-18      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-16      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-12      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-07      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-22      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-17      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-10      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-19      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-13      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-06      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-23      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-15      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-02      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-05      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
O43521_BCL2L11-25      -----------MAKQPSDVSSE------CDREGRQLQPAE----------
Q9BXH1_BBC3-05         ---------------------------------MKFGMGS----AQACPC
Q96LC9_BMF-07          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADL----FAQSLL
Q96LC9_BMF-05          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADL----FAQSLL
Q96LC9_BMF-06          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADL----FAQSLL
Q96LC9_BMF-01          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADL----FAQSLL
Q96LC9_BMF-04          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADL----FAQSLL
Q96LC9_BMF-03          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADL----FAQSLL
Q96LC9_BMF-02          MEPSQCVEELEDDVFQPEDGEP------VTQPGSLLSADL----FAQSLL
Q13323_BIK-01          --------MSEVRPLSRDILME------TLLYEQLLEPPT----M-----
B4DZQ9_BAD-01          --------MFQIPEFEPSEQED------SSSAERGLGPSP----AGDGPS
Q92934_BAD-01          --------MFQIPEFEPSEQED------SSSAERGLGPSP----AGDGPS
Q92934_BAD-02          --------MFQIPEFEPSEQED------SSSAERGLGPSP----AGDGPS
Q92934_BAD-03          --------MFQIPEFEPSEQED------SSSAERGLGPSP----AGDGPS
Q92934_BAD-04          --------MFQIPEFEPSEQED------SSSAERGLGPSP----AGDGPS
                                                                         

Q6JTU4_BCL2L11-01      ---------------MRPE----------------------------IW-
Q13794_PMAIP1-01       ---------------QPSP-------------------------------
Q9BXH1_BBC3-03         ARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLR-
O00198_HRK-01          ---------------SAAQ----------------------------LT-
Q9BXH1_BBC3-04         ---------------GPVQ----------------------------SH-
B4DQK3_BBC3-01         PLGRLVPSAVSCGLCEPGL----------------------------AAA
Q9BXH1_BBC3-06         PLGRLVPSAVSCGLCEPGL----------------------------AAA
Q13794_PMAIP1-02       ---------------QPSP----------------------------ARA
O43521_BCL2L11-11      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-03      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-20      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-09      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-21      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-24      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-08      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-18      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-16      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-12      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-07      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-22      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-17      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-10      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-19      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-13      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-06      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-23      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-15      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-02      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-05      ---------------RPPQ----------------------------LR-
O43521_BCL2L11-25      ---------------RPPQ----------------------------LR-
Q9BXH1_BBC3-05         QVPRAASTTWVPCQICGPQ----------------------------PS-
Q96LC9_BMF-07          DCPLSRLQLFPLTHCCGPG----------------------------LR-
Q96LC9_BMF-05          DCPLSRLQLFPLTHCCGPG----------------------------LR-
Q96LC9_BMF-06          DCPLSRLQLFPLTHCCGPG----------------------------LR-
Q96LC9_BMF-01          DCPLSRLQLFPLTHCCGPG----------------------------LR-
Q96LC9_BMF-04          DCPLSRLQLFPLTHCCGPG----------------------------LR-
Q96LC9_BMF-03          DCPLSRLQLFPLTHCCGPG----------------------------LR-
Q96LC9_BMF-02          DCPLSRLQLFPLTHCCGPG----------------------------LR-
Q13323_BIK-01          -------E--------VLG----------------------------MT-
B4DZQ9_BAD-01          GSGKHHRQ--------APG----------------------------LL-
Q92934_BAD-01          GSGKHHRQ--------APG----------------------------LL-
Q92934_BAD-02          GSGKHHRQ--------APG----------------------------LL-
Q92934_BAD-03          GSGKHHRQ--------APG----------------------------LL-
Q92934_BAD-04          GSGKHHRQ--------APG----------------------------LL-
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       ARAPAELEVE----------------------------------------
Q9BXH1_BBC3-03         PHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQR
O00198_HRK-01          AARLKALGDELH--------------------------------------
Q9BXH1_BBC3-04         HGTP-ALTQGPQSPR-----------------------------------
B4DQK3_BBC3-01         PAAPTLLPAAYLCAP-----------------------------------
Q9BXH1_BBC3-06         PAAPTLLPAAYLCAP-----------------------------------
Q13794_PMAIP1-02       PAGPAGTAGTARDQA-----------------------------------
O43521_BCL2L11-11      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-03      PGAPTSLQTEPQGNP-----------------------------------
O43521_BCL2L11-20      PGAPTSLQTEPQGNP-----------------------------------
O43521_BCL2L11-09      PGAPTSLQTEPQGNP-----------------------------------
O43521_BCL2L11-21      PGAPTSLQTEPQGNP-----------------------------------
O43521_BCL2L11-24      PGAPTSLQTEPQGNP-----------------------------------
O43521_BCL2L11-08      PGAPTSLQTEPQGNP-----------------------------------
O43521_BCL2L11-18      PGAPTSLQTEPQGNP-----------------------------------
O43521_BCL2L11-16      PGAPTSLQTEPQGNP-----------------------------------
O43521_BCL2L11-12      PGAPTSLQTEPQGNP-----------------------------------
O43521_BCL2L11-07      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-22      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-17      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-10      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-19      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-13      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-06      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-23      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-15      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-02      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-05      PGAPTSLQTEPQ--------------------------------------
O43521_BCL2L11-25      PGAPTSLQTEPQ--------------------------------------
Q9BXH1_BBC3-05         LSLAEQHLESPVPSA-----------------------------------
Q96LC9_BMF-07          PTSQEDKATQTLSPA-----------------------------------
Q96LC9_BMF-05          PTSQEDKATQTLSPA-----------------------------------
Q96LC9_BMF-06          PTSQEDKATQTLSPA-----------------------------------
Q96LC9_BMF-01          PTSQEDKATQTLSPA-----------------------------------
Q96LC9_BMF-04          PTSQEDKATQTLSPA-----------------------------------
Q96LC9_BMF-03          PTSQEDKATQTLSPA-----------------------------------
Q96LC9_BMF-02          PTSQEDKATQTLSPA-----------------------------------
Q13323_BIK-01          DSEEDLDPMEDFDSL-----------------------------------
B4DZQ9_BAD-01          WDASHQQEQPTSSSH-----------------------------------
Q92934_BAD-01          WDASHQQEQPTSSSH-----------------------------------
Q92934_BAD-02          WDASHQQEQPTSSSH-----------------------------------
Q92934_BAD-03          WDASHQQEQPTSSSH-----------------------------------
Q92934_BAD-04          WDASHQQEQPTSSSH-----------------------------------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q9BXH1_BBC3-03         PGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAA
O00198_HRK-01          --------------------------------------------------
Q9BXH1_BBC3-04         --------------------------DGAQL-------------------
B4DQK3_BBC3-01         --------------------------TAPPAVTAALGGSRWPGGPRSRPR
Q9BXH1_BBC3-06         --------------------------TAPPAVTAALGGSRWPGGPRSRPR
Q13794_PMAIP1-02       --------------------------GFAIG-------------------
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-03      --------------------------EGNHGGEGDSCPHGSPQGPLAPPA
O43521_BCL2L11-20      --------------------------EGNHGGEGDSCPHGSPQGPLAPPA
O43521_BCL2L11-09      --------------------------EGNHGGEGDSCPHGSPQGPLAPPA
O43521_BCL2L11-21      --------------------------EGNHGGEGDSCPHGSPQGPLAPPA
O43521_BCL2L11-24      --------------------------EGNHGGEGDSCPHGSPQGPLAPPA
O43521_BCL2L11-08      --------------------------EGNHGGEGDSCPHGSPQGPLAPPA
O43521_BCL2L11-18      --------------------------EGNHGGEGDSCPHGSPQGPLAPPA
O43521_BCL2L11-16      --------------------------EGNHGGEGDSCPHGSPQGPLAPPA
O43521_BCL2L11-12      --------------------------EGNHGGEGDSCPHGSPQGPLAPPA
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-19      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-06      --------------------------------------------------
O43521_BCL2L11-23      --------------------------------------------------
O43521_BCL2L11-15      --------------------------------------------------
O43521_BCL2L11-02      --------------------------------------------------
O43521_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-25      --------------------------------------------------
Q9BXH1_BBC3-05         --------------------------PG----------------------
Q96LC9_BMF-07          --------------------------SPSQGV------------------
Q96LC9_BMF-05          --------------------------SPSQGV------------------
Q96LC9_BMF-06          --------------------------SPSQGV------------------
Q96LC9_BMF-01          --------------------------SPSQGV------------------
Q96LC9_BMF-04          --------------------------SPSQGV------------------
Q96LC9_BMF-03          --------------------------SPSQGV------------------
Q96LC9_BMF-02          --------------------------SPSQGV------------------
Q13323_BIK-01          --------------------------ECMEGSDALALRLACIGD------
B4DZQ9_BAD-01          --------------------------HGGAGAVEIRSRHSSYPAGT----
Q92934_BAD-01          --------------------------HGGAGAVEIRSRHSSYPAGT----
Q92934_BAD-02          --------------------------HGGAGAVEIRSRHSSYPAGT----
Q92934_BAD-03          --------------------------HGEGTSSPEERGHSNADAAKLQLD
Q92934_BAD-04          --------------------------HGGRTSYSPSWESEDSENPSAGML
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q9BXH1_BBC3-03         AAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPL
O00198_HRK-01          ------------------------------------QRTMWRRRARSRRA
Q9BXH1_BBC3-04         ---------------------------------GACTRPVDVRDSGGRPL
B4DQK3_BBC3-01         GPRPD----------------------------GPQPSLSLAEQHLESPV
Q9BXH1_BBC3-06         GPRPD----------------------------GPQPSLSLAEQHLESPV
Q13794_PMAIP1-02       -------------------MQLRFTRGKKLLSSSLSSSPLALPRGHEEQV
O43521_BCL2L11-11      --------------------------------------------VSLCHP
O43521_BCL2L11-03      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
O43521_BCL2L11-20      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
O43521_BCL2L11-09      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
O43521_BCL2L11-21      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
O43521_BCL2L11-24      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
O43521_BCL2L11-08      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
O43521_BCL2L11-18      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
O43521_BCL2L11-16      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
O43521_BCL2L11-12      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
O43521_BCL2L11-07      ---------------------------------DRSPAPMSCDKSTQTPS
O43521_BCL2L11-22      ---------------------------------DRSPAPMSCDKSTQTPS
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-19      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-06      ---------------------------------DRSPAPMSCDKSTQTPS
O43521_BCL2L11-23      ---------------------------------DRSPAPMSCDKSTQTPS
O43521_BCL2L11-15      ---------------------------------DRSPAPMSCDKSTQTPS
O43521_BCL2L11-02      ---------------------------------DRSPAPMSCDKSTQTPS
O43521_BCL2L11-05      ---------------------------------DRSPAPMSCDKSTQTPS
O43521_BCL2L11-25      ---------------------------------DRSPAPMSCDKSTQTPS
Q9BXH1_BBC3-05         -----------------------------------------ALAGGPTQA
Q96LC9_BMF-07          -----------------------------------------MLPCGVTEE
Q96LC9_BMF-05          -----------------------------------------MLPCGVTEE
Q96LC9_BMF-06          -----------------------------------------MLPCGVTEE
Q96LC9_BMF-01          -----------------------------------------MLPCGVTEE
Q96LC9_BMF-04          -----------------------------------------MLPCGVTEE
Q96LC9_BMF-03          -----------------------------------------MLPCGVTEE
Q96LC9_BMF-02          -----------------------------------------MLPCGVTEE
Q13323_BIK-01          -----------------------------------------EMDVSLRAP
B4DZQ9_BAD-01          -----------------------------------------EDDEGMGEE
Q92934_BAD-01          -----------------------------------------EDDEGMGEE
Q92934_BAD-02          -----------------------------------------EDDEGMGEE
Q92934_BAD-03          A--------------------------------SLPVLVGSELGQGKLRP
Q92934_BAD-04          A----------------------------------------EASAGMSAP
                                                                         

Q6JTU4_BCL2L11-01      -----------------------------------------IAQELRRIG
Q13794_PMAIP1-01       -----------------------------------------CATQLRRFG
Q9BXH1_BBC3-03         PPPDTLASAGDFLCTM----------------------------------
O00198_HRK-01          PAPGALPTYWPWLCAAAQVAALAAWLLGRRNL------------------
Q9BXH1_BBC3-04         PPPDTLASAGDFLCTM----------------------------------
B4DQK3_BBC3-01         PSAPGALA-------------GGPTQAAPGVRGEEEQWAREIGAQLRRMA
Q9BXH1_BBC3-06         PSAPGALA-------------GGPTQAAPGVRGEEEQWAREIGAQLRRMA
Q13794_PMAIP1-02       QVAGSRVC---YSTQEIWRQTELPAETSESDIQ-----------------
O43521_BCL2L11-11      GWSALVRS---WLTATSNSQVQAVLLPQPPK-------------------
O43521_BCL2L11-03      PPCQAFNH---YLSAM-----ASMRQAEPADMR-PEIW---IAQELRRIG
O43521_BCL2L11-20      PPCQAFNH---YLSAM-----ASMRQAEPADMR-PEIW---IAQELRRIG
O43521_BCL2L11-09      PPCQAFNH---YLSAM-----ASMRQAEPADMR-PEIW---IAQELRRIG
O43521_BCL2L11-21      PPCQAFNH---YLSAM-----ASMRQAEPADMR-PEIW---IAQELRRIG
O43521_BCL2L11-24      PPCQAFNH---YLSAM-----VREIEEVVV--------------------
O43521_BCL2L11-08      PPCQAFNH---YLSAM-----VREIEEVVV--------------------
O43521_BCL2L11-18      PPCQAFNH---YLSAM-----GIFE-------------------------
O43521_BCL2L11-16      PPCQAFNH---YLSAM-----ANWD-------------------------
O43521_BCL2L11-12      PPCQAFNH---YLSAM-----ANWD-------------------------
O43521_BCL2L11-07      PPCQAFNH---YLSAMVREIEEVVV-------------------------
O43521_BCL2L11-22      PPCQAFNH---YLSAMVREIEEVVV-------------------------
O43521_BCL2L11-17      ---------------------ASMRQAEPADMR-PEIW---IAQELRRIG
O43521_BCL2L11-10      ---------------------ASMRQAEPADMR-PEIW---IAQELRRIG
O43521_BCL2L11-19      ---------------------ASMRQAEPADMR-PEIW---IAQELRRIG
O43521_BCL2L11-13      ---------------------ASMRQAEPADMR-PEIW---IAQELRRIG
O43521_BCL2L11-06      PPCQAFNH---YLSAM------VVILEDIGDLSLCFGF---IFTGL----
O43521_BCL2L11-23      PPCQAFNH---YLSAM------VVILEDIGDLSLCFGF---IFTGL----
O43521_BCL2L11-15      PPCQAFNH---YLSAMDDSAGSSLRIALHREVQWPLKW---LAKSS----
O43521_BCL2L11-02      PPCQAFNH---YLSAM-----ASMRQAEPADMR-PEIW---IAQELRRIG
O43521_BCL2L11-05      PPCQAFNH---YLSAM-----ASMRQAEPADMR-PEIW---IAQELRRIG
O43521_BCL2L11-25      PPCQAFNH---YLSAM-----ASMRQAEPADMR-PEIW---IAQELRRIG
Q9BXH1_BBC3-05         AP-----------------------GVRGEEEQWAREI----GAQLRRMA
Q96LC9_BMF-07          PQRLFYAPAE-----PKSCVVADPPLPAQPCFEWRREQE-----------
Q96LC9_BMF-05          PQRLFYAPAE-----PKSCVVADPPLPAQPCFEWRREQE-----------
Q96LC9_BMF-06          PQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAE-----------
Q96LC9_BMF-01          PQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIA
Q96LC9_BMF-04          PQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIA
Q96LC9_BMF-03          PQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIA
Q96LC9_BMF-02          PQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIA
Q13323_BIK-01          RLAQLSE------------------VAMHSLGLAFIYDQ---TEDIRDVL
B4DZQ9_BAD-01          PSPFRGR------------------SRSAPPNLWAAQRY---GRELRRMS
Q92934_BAD-01          PSPFRGR------------------SRSAPPNLWAAQRY---GRELRRMS
Q92934_BAD-02          PSPFRGR------------------SRSAPPNLWAAQRY---GRELRRMS
Q92934_BAD-03          LPVTFAPHPE---------------TPPVPTALGSHLEY---GRKY----
Q92934_BAD-04          AADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKGW---GRS-----
                                                                         

Q6JTU4_BCL2L11-01      DEFNAYYARRLEK-------------------------------------
Q13794_PMAIP1-01       DKLNFRQKLLNLISKLFCSGT-----------------------------
Q9BXH1_BBC3-03         --------------------------------------------------
O00198_HRK-01          --------------------------------------------------
Q9BXH1_BBC3-04         --------------------------------------------------
B4DQK3_BBC3-01         DDLNAQYER-------------RRQEEQQRHRPSPWRVLYNLIMGLLPLP
Q9BXH1_BBC3-06         DDLNAQYER-------------RRQEEQQRHRPSPWRVLYNLIMGLLPLP
Q13794_PMAIP1-02       ----TLLLR-------------NLTASKTCMRGLLQKSFLRRCTFHQFEE
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-03      DEFNAYYAR-------------RVFLNNYQAAEDHPRMVILRLLRYIVRL
O43521_BCL2L11-20      DEFNAYYAR-------------RLEK------------------------
O43521_BCL2L11-09      DEFNAYYAR-------------RMPLPPD---------------------
O43521_BCL2L11-21      DEFNAYYAR-------------RMPLPPD---------------------
O43521_BCL2L11-24      --------------------------------------------------
O43521_BCL2L11-08      --------------------------------------------------
O43521_BCL2L11-18      --------------------------------------------------
O43521_BCL2L11-16      --------------------------------------------------
O43521_BCL2L11-12      --------------------------------------------------
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-17      DEFNAYYAR-------------RMPLPPD---------------------
O43521_BCL2L11-10      DEFNAYYAR-------------RMPLPPD---------------------
O43521_BCL2L11-19      DEFNAYYAR-------------RLAKLLASST------------------
O43521_BCL2L11-13      DEFNAYYAR-------------RLAKLLASST------------------
O43521_BCL2L11-06      DLYGHHHSQ-------------DTEQLNHKDFS-----------------
O43521_BCL2L11-23      DLYGHHHSQ-------------DTEQLNHKDFS-----------------
O43521_BCL2L11-15      --------------------------------------------------
O43521_BCL2L11-02      DEFNAYYAR-------------RVFLNNYQAAEDHPRMVILRLLRYIVRL
O43521_BCL2L11-05      DEFNAYYAR-------------RLEK------------------------
O43521_BCL2L11-25      DEFNAYYAR-------------RLEK------------------------
Q9BXH1_BBC3-05         DDLNAQYER-------------RRQEEQQRHRPSPWRVLYNLIMGLLPLP
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-06          --------------------------HQQNQNRVWWQIL--LFLHNLALN
Q96LC9_BMF-01          DQFHRLHVQ----------------QHQQNQNRVWWQIL--LFLHNLALN
Q96LC9_BMF-04          DQFHRLHVQ----------------QHQQNQNRVWWQIL--LFLHNLALN
Q96LC9_BMF-03          DQFHRLHVQ----------------QHQQNQNRVWWQIL--LFLHNLALN
Q96LC9_BMF-02          DQFHRLHVQ----------------QHQQNQNRVWWQIL--LFLHNLALN
Q13323_BIK-01          RSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLL--LALLLPLLS
B4DZQ9_BAD-01          DEFVDSF-K-----KGLPRPKSAGTATQMRQSPRRLR-------------
Q92934_BAD-01          DEFVDSF-K-----KGLPRPKSAGTATQMRQSSSWTRVF--QSWWDRNLG
Q92934_BAD-02          DEFVDSF-K-----KGLPRPKSAGTATQMRQSSSWTRVF--QSWWDRNLG
Q92934_BAD-03          --FPQAYAK-----RGSVLSPLEGGLTQIPFRCV----------------
Q92934_BAD-04          ---PAPFGA-----ARARRPPTSGQHSAMAASSGG---------------
                                                                         

Q6JTU4_BCL2L11-01      -----------
Q13794_PMAIP1-01       -----------
Q9BXH1_BBC3-03         -----------
O00198_HRK-01          -----------
Q9BXH1_BBC3-04         -----------
B4DQK3_BBC3-01         RGHRAPEMEPN
Q9BXH1_BBC3-06         RGHRAPEMEPN
Q13794_PMAIP1-02       RLHCN------
O43521_BCL2L11-11      -----------
O43521_BCL2L11-03      VWRMH------
O43521_BCL2L11-20      -----------
O43521_BCL2L11-09      -----------
O43521_BCL2L11-21      -----------
O43521_BCL2L11-24      -----------
O43521_BCL2L11-08      -----------
O43521_BCL2L11-18      -----------
O43521_BCL2L11-16      -----------
O43521_BCL2L11-12      -----------
O43521_BCL2L11-07      -----------
O43521_BCL2L11-22      -----------
O43521_BCL2L11-17      -----------
O43521_BCL2L11-10      -----------
O43521_BCL2L11-19      -----------
O43521_BCL2L11-13      -----------
O43521_BCL2L11-06      -----------
O43521_BCL2L11-23      -----------
O43521_BCL2L11-15      -----------
O43521_BCL2L11-02      VWRMH------
O43521_BCL2L11-05      -----------
O43521_BCL2L11-25      -----------
Q9BXH1_BBC3-05         RGHRAPEMEPN
Q96LC9_BMF-07          -------RGRP
Q96LC9_BMF-05          -------RGRP
Q96LC9_BMF-06          GEENRNGAGPR
Q96LC9_BMF-01          GEENRNGAGPR
Q96LC9_BMF-04          GEENRNGAGPR
Q96LC9_BMF-03          GEENRNGAGPR
Q96LC9_BMF-02          GEENRNGAGPR
Q13323_BIK-01          GGLHLLLK---
B4DZQ9_BAD-01          -----------
Q92934_BAD-01          RGSSAPSQ---
Q92934_BAD-02          RGSSAPSQ---
Q92934_BAD-03          -----------
Q92934_BAD-04          -----------
                                  

© 1998-2019