Dataset for protein Bmf of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q96LC9_BMF-07      MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
Q96LC9_BMF-05      MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
Q96LC9_BMF-01      MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
Q96LC9_BMF-02      MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
Q96LC9_BMF-03      MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
Q96LC9_BMF-04      MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
Q96LC9_BMF-06      MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
                   ************************************************************

Q96LC9_BMF-07      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAE-----PKSCVVADPPLPAQ
Q96LC9_BMF-05      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAE-----PKSCVVADPPLPAQ
Q96LC9_BMF-01      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
Q96LC9_BMF-02      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
Q96LC9_BMF-03      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
Q96LC9_BMF-04      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
Q96LC9_BMF-06      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
                   *************************************. *      * *  .. *     

Q96LC9_BMF-07      PCFEWRREQE--------------------------------------------------
Q96LC9_BMF-05      PCFEWRREQE--------------------------------------------------
Q96LC9_BMF-01      PEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG
Q96LC9_BMF-02      PEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG
Q96LC9_BMF-03      PEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG
Q96LC9_BMF-04      PEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG
Q96LC9_BMF-06      PEGQWQHQAE---------------------HQQNQNRVWWQILLFLHNLALNGEENRNG
                   *  :*..: *                                                  

Q96LC9_BMF-07      RGRP
Q96LC9_BMF-05      RGRP
Q96LC9_BMF-01      AGPR
Q96LC9_BMF-02      AGPR
Q96LC9_BMF-03      AGPR
Q96LC9_BMF-04      AGPR
Q96LC9_BMF-06      AGPR
                    *  

© 1998-2019