Dataset for protein Bim of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

23 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01       ---------------MRQAEP-----------------------------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A0C4DH20_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                                        ** :*                             

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A0C4DH20_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A0C4DH20_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A0C4DH20_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A0C4DH20_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A0C4DH20_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A0C4DH20_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A0C4DH20_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A0C4DH20_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       -----------------------------------------ADMRPEIWI
A0A0C4DH20_BCL2L11      -------------VSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK---
A0A0C4DH20_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLRIALHREVQWP
A0A0C4DH20_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVV--V--------
A0A0C4DH20_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVV--V--------
A0A0C4DH20_BCL2L11      -------------------------------ASMRQAEP--ADMRPEIWI
A0A0C4DH20_BCL2L11      -------------------------------ASMRQAEP--ADMRPEIWI
A0A0C4DH20_BCL2L11      -------------------------------ASMRQAEP--ADMRPEIWI
A0A0C4DH20_BCL2L11      -------------------------------ASMRQAEP--ADMRPEIWI
A0A0C4DH20_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVV--V--------
A0A0C4DH20_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVV--V--------
A0A0C4DH20_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD---------------
A0A0C4DH20_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD---------------
A0A0C4DH20_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE---------------
A0A0C4DH20_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWI
A0A0C4DH20_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWI
A0A0C4DH20_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWI
A0A0C4DH20_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWI
A0A0C4DH20_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVI----------------
A0A0C4DH20_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVI----------------
A0A0C4DH20_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWI
A0A0C4DH20_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWI
A0A0C4DH20_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEP--ADMRPEIWI
                                                                          

Q6JTU4_BCL2L11-01       AQELRRIG-------------DEFNAYYARRLEK----------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      LKWLAKSS------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      AQELRRIG-------------DEFNAYYARRMPLPPD-------------
A0A0C4DH20_BCL2L11      AQELRRIG-------------DEFNAYYARRMPLPPD-------------
A0A0C4DH20_BCL2L11      AQELRRIG-------------DEFNAYYARRLAKLLASST----------
A0A0C4DH20_BCL2L11      AQELRRIG-------------DEFNAYYARRLAKLLASST----------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      --------------------------------------------------
A0A0C4DH20_BCL2L11      AQELRRIG-------------DEFNAYYARRVFLNNYQAAEDHPRMVILR
A0A0C4DH20_BCL2L11      AQELRRIG-------------DEFNAYYARRMPLPPD-------------
A0A0C4DH20_BCL2L11      AQELRRIG-------------DEFNAYYARRMPLPPD-------------
A0A0C4DH20_BCL2L11      AQELRRIG-------------DEFNAYYARRLEK----------------
A0A0C4DH20_BCL2L11      ---LEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS---------
A0A0C4DH20_BCL2L11      ---LEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS---------
A0A0C4DH20_BCL2L11      AQELRRIG-------------DEFNAYYARRVFLNNYQAAEDHPRMVILR
A0A0C4DH20_BCL2L11      AQELRRIG-------------DEFNAYYARRLEK----------------
A0A0C4DH20_BCL2L11      AQELRRIG-------------DEFNAYYARRLEK----------------
                                                                          

Q6JTU4_BCL2L11-01       -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      LLRYIVRLVWRMH
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      LLRYIVRLVWRMH
A0A0C4DH20_BCL2L11      -------------
A0A0C4DH20_BCL2L11      -------------
                                     

© 1998-2018