Dataset for protein Bim of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

23 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-03      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-20      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-09      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-21      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-24      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-08      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-18      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-16      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-12      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-07      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-22      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-17      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-10      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-19      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-13      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-06      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-23      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-15      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-02      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-05      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-25      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-03      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-20      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-09      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-21      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-24      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-08      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-18      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-16      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-12      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-19      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-06      --------------------------------------------------
O43521_BCL2L11-23      --------------------------------------------------
O43521_BCL2L11-15      --------------------------------------------------
O43521_BCL2L11-02      --------------------------------------------------
O43521_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-25      --------------------------------------------------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------MRQAEPADMR-P
O43521_BCL2L11-11      ------------VSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK----
O43521_BCL2L11-03      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-20      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-09      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-21      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-24      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV-----
O43521_BCL2L11-08      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV-----
O43521_BCL2L11-18      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----GIFE----------
O43521_BCL2L11-16      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ANWD----------
O43521_BCL2L11-12      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ANWD----------
O43521_BCL2L11-07      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
O43521_BCL2L11-22      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
O43521_BCL2L11-17      ------------------------------------ASMRQAEPADMR-P
O43521_BCL2L11-10      ------------------------------------ASMRQAEPADMR-P
O43521_BCL2L11-19      ------------------------------------ASMRQAEPADMR-P
O43521_BCL2L11-13      ------------------------------------ASMRQAEPADMR-P
O43521_BCL2L11-06      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM------VVILEDIGDLSLC
O43521_BCL2L11-23      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM------VVILEDIGDLSLC
O43521_BCL2L11-15      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLRIALHREVQWP
O43521_BCL2L11-02      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-05      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-25      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
                                                                         

Q6JTU4_BCL2L11-01      EIWIAQELRRIGDEFNAYYARRLEK-------------------------
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-03      EIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLV
O43521_BCL2L11-20      EIWIAQELRRIGDEFNAYYARRLEK-------------------------
O43521_BCL2L11-09      EIWIAQELRRIGDEFNAYYARRMPLPPD----------------------
O43521_BCL2L11-21      EIWIAQELRRIGDEFNAYYARRMPLPPD----------------------
O43521_BCL2L11-24      --------------------------------------------------
O43521_BCL2L11-08      --------------------------------------------------
O43521_BCL2L11-18      --------------------------------------------------
O43521_BCL2L11-16      --------------------------------------------------
O43521_BCL2L11-12      --------------------------------------------------
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-17      EIWIAQELRRIGDEFNAYYARRMPLPPD----------------------
O43521_BCL2L11-10      EIWIAQELRRIGDEFNAYYARRMPLPPD----------------------
O43521_BCL2L11-19      EIWIAQELRRIGDEFNAYYARRLAKLLASST-------------------
O43521_BCL2L11-13      EIWIAQELRRIGDEFNAYYARRLAKLLASST-------------------
O43521_BCL2L11-06      FGFIFTGL----DLYGHHHSQDTEQLNHKDFS------------------
O43521_BCL2L11-23      FGFIFTGL----DLYGHHHSQDTEQLNHKDFS------------------
O43521_BCL2L11-15      LKWLAKSS------------------------------------------
O43521_BCL2L11-02      EIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLV
O43521_BCL2L11-05      EIWIAQELRRIGDEFNAYYARRLEK-------------------------
O43521_BCL2L11-25      EIWIAQELRRIGDEFNAYYARRLEK-------------------------
                                                                         

Q6JTU4_BCL2L11-01      ----
O43521_BCL2L11-11      ----
O43521_BCL2L11-03      WRMH
O43521_BCL2L11-20      ----
O43521_BCL2L11-09      ----
O43521_BCL2L11-21      ----
O43521_BCL2L11-24      ----
O43521_BCL2L11-08      ----
O43521_BCL2L11-18      ----
O43521_BCL2L11-16      ----
O43521_BCL2L11-12      ----
O43521_BCL2L11-07      ----
O43521_BCL2L11-22      ----
O43521_BCL2L11-17      ----
O43521_BCL2L11-10      ----
O43521_BCL2L11-19      ----
O43521_BCL2L11-13      ----
O43521_BCL2L11-06      ----
O43521_BCL2L11-23      ----
O43521_BCL2L11-15      ----
O43521_BCL2L11-02      WRMH
O43521_BCL2L11-05      ----
O43521_BCL2L11-25      ----
                           

© 1998-2019