Dataset for protein Bim of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

23 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-22      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-08      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-24      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-12      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-21      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-03      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-18      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-16      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-09      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-10      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-20      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-17      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-13      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-07      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-19      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-23      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-06      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-15      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-02      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-05      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-25      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-11      --------------------------------------VSLCHPGWSALV
O43521_BCL2L11-22      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-08      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-24      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-12      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-21      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-03      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-18      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-16      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-09      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-20      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-19      --------------------------------------------------
O43521_BCL2L11-23      --------------------------------------------------
O43521_BCL2L11-06      --------------------------------------------------
O43521_BCL2L11-15      --------------------------------------------------
O43521_BCL2L11-02      --------------------------------------------------
O43521_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-25      --------------------------------------------------
                                                                         

Q6JTU4_BCL2L11-01      ----------------------------------MRQAEPADMRPEIWIA
O43521_BCL2L11-11      RSWLTATSNSQVQAVLLPQPPK----------------------------
O43521_BCL2L11-22      TDRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMVREIEEVVV---------
O43521_BCL2L11-08      TDRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMVREIEEVVV---------
O43521_BCL2L11-24      TDRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMANWD--------------
O43521_BCL2L11-12      TDRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMANWD--------------
O43521_BCL2L11-21      TDRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMGIFE--------------
O43521_BCL2L11-03      TDRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIA
O43521_BCL2L11-18      TDRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIA
O43521_BCL2L11-16      TDRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIA
O43521_BCL2L11-09      TDRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIA
O43521_BCL2L11-10      --------------------------------ASMRQAEPADMRPEIWIA
O43521_BCL2L11-20      --------------------------------ASMRQAEPADMRPEIWIA
O43521_BCL2L11-17      --------------------------------ASMRQAEPADMRPEIWIA
O43521_BCL2L11-13      --------------------------------ASMRQAEPADMRPEIWIA
O43521_BCL2L11-07      -DRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMV-----------------
O43521_BCL2L11-19      -DRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMV-----------------
O43521_BCL2L11-23      -DRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMD-----------------
O43521_BCL2L11-06      -DRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMVVI---------------
O43521_BCL2L11-15      -DRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMVVI---------------
O43521_BCL2L11-02      -DRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIA
O43521_BCL2L11-05      -DRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIA
O43521_BCL2L11-25      -DRSPAPMSCD-KSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIA
                                                                         

Q6JTU4_BCL2L11-01      QELRRIG-------------DEFNAYYARRLEK-----------------
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-08      --------------------------------------------------
O43521_BCL2L11-24      --------------------------------------------------
O43521_BCL2L11-12      --------------------------------------------------
O43521_BCL2L11-21      --------------------------------------------------
O43521_BCL2L11-03      QELRRIG-------------DEFNAYYARRVFLNNYQAAEDHPRMVILRL
O43521_BCL2L11-18      QELRRIG-------------DEFNAYYARRLEK-----------------
O43521_BCL2L11-16      QELRRIG-------------DEFNAYYARRMPLPPD--------------
O43521_BCL2L11-09      QELRRIG-------------DEFNAYYARRMPLPPD--------------
O43521_BCL2L11-10      QELRRIG-------------DEFNAYYARRMPLPPD--------------
O43521_BCL2L11-20      QELRRIG-------------DEFNAYYARRMPLPPD--------------
O43521_BCL2L11-17      QELRRIG-------------DEFNAYYARRLAKLLASST-----------
O43521_BCL2L11-13      QELRRIG-------------DEFNAYYARRLAKLLASST-----------
O43521_BCL2L11-07      ------------------------------------REIEEVVV------
O43521_BCL2L11-19      ------------------------------------REIEEVVV------
O43521_BCL2L11-23      ------------------------------------DSAGSSLRIALHRE
O43521_BCL2L11-06      --LEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS----------
O43521_BCL2L11-15      --LEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS----------
O43521_BCL2L11-02      QELRRIG-------------DEFNAYYARRVFLNNYQAAEDHPRMVILRL
O43521_BCL2L11-05      QELRRIG-------------DEFNAYYARRLEK-----------------
O43521_BCL2L11-25      QELRRIG-------------DEFNAYYARRLEK-----------------
                                                                         

Q6JTU4_BCL2L11-01      ------------
O43521_BCL2L11-11      ------------
O43521_BCL2L11-22      ------------
O43521_BCL2L11-08      ------------
O43521_BCL2L11-24      ------------
O43521_BCL2L11-12      ------------
O43521_BCL2L11-21      ------------
O43521_BCL2L11-03      LRYIVRLVWRMH
O43521_BCL2L11-18      ------------
O43521_BCL2L11-16      ------------
O43521_BCL2L11-09      ------------
O43521_BCL2L11-10      ------------
O43521_BCL2L11-20      ------------
O43521_BCL2L11-17      ------------
O43521_BCL2L11-13      ------------
O43521_BCL2L11-07      ------------
O43521_BCL2L11-19      ------------
O43521_BCL2L11-23      VQWPLKWLAKSS
O43521_BCL2L11-06      ------------
O43521_BCL2L11-15      ------------
O43521_BCL2L11-02      LRYIVRLVWRMH
O43521_BCL2L11-05      ------------
O43521_BCL2L11-25      ------------
                                   

© 1998-2019