Dataset for protein Bim of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

23 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01      ---------------MRQAEPA----------------------------
O43521_BCL2L11-02      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-08      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-22      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-24      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-12      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-21      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-03      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-18      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-16      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-09      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-19      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-07      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-23      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-10      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-20      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-17      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-13      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-06      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-15      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-05      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-25      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                                       ** :**                            

Q6JTU4_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-02      --------------------------------------------------
O43521_BCL2L11-08      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-22      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-24      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-12      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-21      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-03      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-18      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-16      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-09      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-19      --------------------------------------------------
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-23      --------------------------------------------------
O43521_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-20      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-06      --------------------------------------------------
O43521_BCL2L11-15      --------------------------------------------------
O43521_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-25      --------------------------------------------------
                                                                         

Q6JTU4_BCL2L11-01      ------------------------------------------DMRPEIWI
O43521_BCL2L11-02      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA--DMRPEIWI
O43521_BCL2L11-08      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
O43521_BCL2L11-22      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
O43521_BCL2L11-24      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD---------------
O43521_BCL2L11-12      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD---------------
O43521_BCL2L11-21      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE---------------
O43521_BCL2L11-03      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA--DMRPEIWI
O43521_BCL2L11-18      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA--DMRPEIWI
O43521_BCL2L11-16      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA--DMRPEIWI
O43521_BCL2L11-09      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA--DMRPEIWI
O43521_BCL2L11-11      -------------VSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK---
O43521_BCL2L11-19      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
O43521_BCL2L11-07      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
O43521_BCL2L11-23      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLRIALHREVQWP
O43521_BCL2L11-10      -------------------------------ASMRQAEPA--DMRPEIWI
O43521_BCL2L11-20      -------------------------------ASMRQAEPA--DMRPEIWI
O43521_BCL2L11-17      -------------------------------ASMRQAEPA--DMRPEIWI
O43521_BCL2L11-13      -------------------------------ASMRQAEPA--DMRPEIWI
O43521_BCL2L11-06      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVI----------------
O43521_BCL2L11-15      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVI----------------
O43521_BCL2L11-05      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA--DMRPEIWI
O43521_BCL2L11-25      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA--DMRPEIWI
                                                                         

Q6JTU4_BCL2L11-01      AQELRRIG-------------DEFNAYYARRLEK----------------
O43521_BCL2L11-02      AQELRRIG-------------DEFNAYYARRVFLNNYQAAEDHPRMVILR
O43521_BCL2L11-08      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-24      --------------------------------------------------
O43521_BCL2L11-12      --------------------------------------------------
O43521_BCL2L11-21      --------------------------------------------------
O43521_BCL2L11-03      AQELRRIG-------------DEFNAYYARRVFLNNYQAAEDHPRMVILR
O43521_BCL2L11-18      AQELRRIG-------------DEFNAYYARRLEK----------------
O43521_BCL2L11-16      AQELRRIG-------------DEFNAYYARRMPLPPD-------------
O43521_BCL2L11-09      AQELRRIG-------------DEFNAYYARRMPLPPD-------------
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-19      --------------------------------------------------
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-23      LKWLAKSS------------------------------------------
O43521_BCL2L11-10      AQELRRIG-------------DEFNAYYARRMPLPPD-------------
O43521_BCL2L11-20      AQELRRIG-------------DEFNAYYARRMPLPPD-------------
O43521_BCL2L11-17      AQELRRIG-------------DEFNAYYARRLAKLLASST----------
O43521_BCL2L11-13      AQELRRIG-------------DEFNAYYARRLAKLLASST----------
O43521_BCL2L11-06      ---LEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS---------
O43521_BCL2L11-15      ---LEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS---------
O43521_BCL2L11-05      AQELRRIG-------------DEFNAYYARRLEK----------------
O43521_BCL2L11-25      AQELRRIG-------------DEFNAYYARRLEK----------------
                                                                         

Q6JTU4_BCL2L11-01      -------------
O43521_BCL2L11-02      LLRYIVRLVWRMH
O43521_BCL2L11-08      -------------
O43521_BCL2L11-22      -------------
O43521_BCL2L11-24      -------------
O43521_BCL2L11-12      -------------
O43521_BCL2L11-21      -------------
O43521_BCL2L11-03      LLRYIVRLVWRMH
O43521_BCL2L11-18      -------------
O43521_BCL2L11-16      -------------
O43521_BCL2L11-09      -------------
O43521_BCL2L11-11      -------------
O43521_BCL2L11-19      -------------
O43521_BCL2L11-07      -------------
O43521_BCL2L11-23      -------------
O43521_BCL2L11-10      -------------
O43521_BCL2L11-20      -------------
O43521_BCL2L11-17      -------------
O43521_BCL2L11-13      -------------
O43521_BCL2L11-06      -------------
O43521_BCL2L11-15      -------------
O43521_BCL2L11-05      -------------
O43521_BCL2L11-25      -------------
                                    

© 1998-2019