Dataset for protein Puma of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9BXH1_BBC3-04      MKFGMGSAQACPCQVPRAASTTWVPCQIC-------------------------------
Q9BXH1_BBC3-05      MKFGMGSAQACPCQVPRAASTTWVPCQIC-------------------------------
Q9BXH1_BBC3-03      MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLP
B4DQK3_BBC3-01      MAPGSAMA-----------------------RARQEGSSPEPVEGLARDGP---RPFPLG
Q9BXH1_BBC3-06      ------MA-----------------------RARQEGSSPEPVEGLARDGP---RPFPLG
                           *                                                    

Q9BXH1_BBC3-04      ------------------------------------------------------------
Q9BXH1_BBC3-05      ------------------------------------------------------------
Q9BXH1_BBC3-03      ARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAP
B4DQK3_BBC3-01      RLVPSAVSCGL-------------------CEPGLAAAPAAPTLLPAAY-------LCAP
Q9BXH1_BBC3-06      RLVPSAVSCGL-------------------CEPGLAAAPAAPTLLPAAY-------LCAP
                                                                                

Q9BXH1_BBC3-04      -----------------------------------------------------------E
Q9BXH1_BBC3-05      -----------------------------------------------------------G
Q9BXH1_BBC3-03      RPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGS-PRGGGTVGPGDRGPAAADG
B4DQK3_BBC3-01      TAPPAVTAAL-------------------GGSRWPGGPRSRPRG-----------PRPDG
Q9BXH1_BBC3-06      TAPPAVTAAL-------------------GGSRWPGGPRSRPRG-----------PRPDG
                                                                                

Q9BXH1_BBC3-04      TRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGA-----------QLGACTRPV----
Q9BXH1_BBC3-05      PQPSLSLAEQHLESPVPSAPG--ALAGGPTQAAPGVRG--EEEQWAREIGAQLRRMADDL
Q9BXH1_BBC3-03      GRPQRTVRAAETRGAAAAPPL--TLE-GPVQSHHGTPALTQGPQSPRD-GAQLGACTRPV
B4DQK3_BBC3-01      PQPSLSLAEQHLESPVPSAPG--ALAGGPTQAAPGVRG--EEEQWAREIGAQLRRMADDL
Q9BXH1_BBC3-06      PQPSLSLAEQHLESPVPSAPG--ALAGGPTQAAPGVRG--EEEQWAREIGAQLRRMADDL
                     .   :       ... :     :*  ** ..  *.           : **         

Q9BXH1_BBC3-04      ----DVRDSGGRPLPPPDTLASAGDFLCTM---------------
Q9BXH1_BBC3-05      NAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
Q9BXH1_BBC3-03      DVRDSGGRPLPPPDTLASAGDFLCTM-------------------
B4DQK3_BBC3-01      NAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
Q9BXH1_BBC3-06      NAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
                        .           ...      :                   

© 1998-2019