Dataset for protein Bad of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q92934_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
Q92934_BAD-04      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
B4DZQ9_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
Q92934_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
Q92934_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
                   ************************************************************

Q92934_BAD-03      HGE---------------GTSSPEERGHSNADAAKLQLDASLPVLVGSELGQGKLRPLPV
Q92934_BAD-04      HGG---------RTSYSPSWESED--SENPSAGMLAEASAGMSAPAADSEAQ-HAENVKL
B4DZQ9_BAD-01      HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSD
Q92934_BAD-02      HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSD
Q92934_BAD-01      HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSD
                   **                . .. :  . . :     . .*     ...  ..     :  

Q92934_BAD-03      TFA----------PHPETPPVPTALGSHLEYGR---KYFPQAYAKRGSVLSPLEGGLTQI
Q92934_BAD-04      EALGLWRSGVATAPTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG-----
B4DZQ9_BAD-01      EFVDSFKKGL---PRPKSAGTATQMRQSPRRLR---------------------------
Q92934_BAD-02      EFVDSFKKGL---PRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------
Q92934_BAD-01      EFVDSFKKGL---PRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------
                                * *    ...                                     

Q92934_BAD-03      PFRCV
Q92934_BAD-04      -----
B4DZQ9_BAD-01      -----
Q92934_BAD-02      -----
Q92934_BAD-01      -----
                        

© 1998-2018