Dataset for protein classical BH3-containing proteins of organism Hippocampus comes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2YCX7_BMF-01      --------------------MEDEEDDVFEPDPHCWRTTFKEI-------
A0A3Q2YCX7_BMF-02      --------------------MEDEEDDVFEPDPHCWRTTFKEI-------
A0A3Q2Y0E4_BAD-01      MAANFSISDSESEPSEEVEEGDDGQGAAEKEQEQCLRQGLRLTLPELPME
                                            :* :. . : : :* *  :.         

A0A3Q2YCX7_BMF-01      ------------------KCEERATQTPGPVPASNNGMLPCGVAEEPRPL
A0A3Q2YCX7_BMF-02      ------------------KCEERATQTPGPVPASNNGMLPCGVAEEPRPL
A0A3Q2Y0E4_BAD-01      AMSGRIRLNSESHALAVSREEEFQARVDEEVGTPTDGAPFRGRSKSAPPV
                                         . **  :..   * :..:*    * ::.. *:

A0A3Q2YCX7_BMF-01      FYGNAGFRLHFPAHFELVGEQEERLQESDDGMEQQLQQQQQQQPVARSIE
A0A3Q2YCX7_BMF-02      FYGNAGFRLHFPAHFELVGEQEERLQESDDGMEQQLQQQQQQQPVARSIE
A0A3Q2Y0E4_BAD-01      LWAAKKY--------------GRQLRRMSDEFDSLMDKGELKFKSAGGTS
                       ::.   :                .*.  .* ::. ::: : :   * . .

A0A3Q2YCX7_BMF-01      ACVGQKLQLIGDQFHREHLQLVSRNQHKHK-------
A0A3Q2YCX7_BMF-02      ACVGQKLQLIGDQFHREHLQLVSRNQHKHK-------
A0A3Q2Y0E4_BAD-01      RAIHHSKTWWSYLFSHQETEGENNNNNHHDNHANRTE
                        .: :.    .  * .:  :  ..*:::*.       

© 1998-2019