Dataset for protein classical BH3-containing proteins of organism Haplochromis burtoni

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3C5V2_BMF-01      MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAE
A0A3Q3C680_BAD-01      ---------------MAANFKISDSDSEASEEVG----EEENQQSAGQAQ
                                        :.*.  ..:  .::  *     ::.  ..* *:

A0A3Q3C5V2_BMF-01      EPRPLFYGNAGFRLHFPARFELVGDHRASRQGSTE--------------Q
A0A3Q3C680_BAD-01      ESKPQTLSLPVIKTTAAGRLRVNSESHTSSIARDEELMARGEDEVCTPTE
                       *..*   . . :.   ..*: : .: .:*  .  *              :

A0A3Q3C5V2_BMF-01      QNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQR-----
A0A3Q3C680_BAD-01      GDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFD----SLLDKGEMKVKKL
                        :.: * ... *.*  .    *.:*. :.*:*     .*  ..:      

A0A3Q3C5V2_BMF-01      NQGPMWWRLAAAILSLLFDRGFIAGGGGGGRR------
A0A3Q3C680_BAD-01      HHSKTWW-------SYLFSHQETEGENNHLENHNQRTE
                       ::.  **       * **..    * ..   .      

© 1998-2019