Dataset for protein classical BH3-containing proteins of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YVQ5_PMAIP1-      -------------MPGKKARKNAQPSPARAPA------------------
G3QIN5_BMF-02           --MEPSQCVEELEDD--VFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSR
G3QTJ6_HRK-01           MCPCP------------LHRGRGPPAVCACSAG-----------------
G3QIN5_BMF-01           --MEPSQCVEELEDD--VFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSR
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YVQ5_PMAIP1-      ---MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIEMQLRFTRGKKLLS
G3QCT2_BIK-01           MSEVRPLSRDILMETLLYEQLLEPPTM----------------------E
A0A2I2Z8C7_BAD-01       MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSG----------SGKHHRQ
A0A2I2Z8C7_BAD-02       MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSG----------SGKHHRQ
A0A2I2Z8C7_BAD-03       MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSG----------SGKHHRQ
A0A2I2Z8C7_BAD-04       MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSG----------SGKHHRQ
                                                                          

A0A2I2YVQ5_PMAIP1-      ----------ELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT-----
G3QIN5_BMF-02           LQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPC----------
G3QTJ6_HRK-01           ----RLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSR----------
G3QIN5_BMF-01           LQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPC----------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPA----------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPA----------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPA----------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPA----------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPA----------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPA----------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2I2YVQ5_PMAIP1-      SSPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQT-----
G3QCT2_BIK-01           VLGVTDSEEDLDPMEDFDSLECMEGSDALALRLACIGD------------
A0A2I2Z8C7_BAD-01       APGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGT----------
A0A2I2Z8C7_BAD-02       APGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGT----------
A0A2I2Z8C7_BAD-03       APGLLWDASHQQEQPTSSSHHGEGTSSPEERRHSNADAAKLQLDASLPVL
A0A2I2Z8C7_BAD-04       APGLLWDASHQQEQPTSSSHHGGRTSYSPSWESEDSENPSAGMLA-----
                                                                          

A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
G3QIN5_BMF-02           ----------------------------------GVTEEPQRLFYAPAEP
G3QTJ6_HRK-01           -------------------------------------RAPAPGALPTYWP
G3QIN5_BMF-01           ---GVTEEPQR------------LFYGNAGYRLPLPASFPAVLPIGE---
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      ------------------------------------DRSPAPMSCDKSTQ
A0A2I2YQ13_BCL2L11      ---SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2I2YQ13_BCL2L11      ---SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2I2YQ13_BCL2L11      ---SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2I2YQ13_BCL2L11      ---SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2I2YQ13_BCL2L11      ---SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2I2YQ13_BCL2L11      ---SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2I2YQ13_BCL2L11      ------------------------------------DRSPAPMSCDKSTQ
A0A2I2YQ13_BCL2L11      ------------------------------------DRSPAPMSCDKSTQ
A0A2I2YVQ5_PMAIP1-      ---LLLRNLTASKTCMRGL------------------LQKSFLRRCTFHQ
G3QCT2_BIK-01           ---EMDVSLRAPRLAQLSE------------------VAMHSLGLAFIYD
A0A2I2Z8C7_BAD-01       ---EDDEGMGEEPSPFRGR------------------SRSAPPNLWAAQR
A0A2I2Z8C7_BAD-02       ---EDDEGMGEEPSPFRGR------------------SRSAPPNLWAAQR
A0A2I2Z8C7_BAD-03       VGSELGQGKLRPLPVTFAAHPE---------------TPPVPTALGSHLE
A0A2I2Z8C7_BAD-04       ---EASAGMSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKG
                                                                          

A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
G3QIN5_BMF-02           KSCVVADPPLPAQPCFEWRREQERGRP-----------------------
G3QTJ6_HRK-01           WLCAAAQVAALAAWLLGRRNL-----------------------------
G3QIN5_BMF-01           --QPPEGQWQH----------------RAEVQIARKLQCIADQFHRLHVQ
A0A2I2YQ13_BCL2L11      ----------------ASMRQAEPADMRPEIWIAQELRRIGDEFNAYYAR
A0A2I2YQ13_BCL2L11      TPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYAR
A0A2I2YQ13_BCL2L11      TPSPPCQAFNHYLSAMGIFE------------------------------
A0A2I2YQ13_BCL2L11      TPSPPCQAFNHYLSAMANWD------------------------------
A0A2I2YQ13_BCL2L11      TPSPPCQAFNHYLSAMVREIEEVVV-------------------------
A0A2I2YQ13_BCL2L11      TPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYAR
A0A2I2YQ13_BCL2L11      TPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYAR
A0A2I2YQ13_BCL2L11      TPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYAR
A0A2I2YQ13_BCL2L11      TPSPPCQAFNHYLSAMVVILEDIGDLSLWFGFIFTGLDLYGHHHSQDTEQ
A0A2I2YQ13_BCL2L11      TPSPPCQAFNHYLSAM----DDSAGSSLRIAL------------------
A0A2I2YVQ5_PMAIP1-      FEERLHCNWEECEGAFMG--------------------------------
G3QCT2_BIK-01           QTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLALLLLLA
A0A2I2Z8C7_BAD-01       YGRELRRMSDEFVDSF-K-----KGLPRPKSAGTATQMRQSSSWTRVFQS
A0A2I2Z8C7_BAD-02       YGRELRRMSDEFVDSF-K-----KGLPRPKSAGTATQMRQSSSWTRVFQS
A0A2I2Z8C7_BAD-03       YGRKY------FPQAYAK-----RGSVLSPLEGRLTQIPFRCV-------
A0A2I2Z8C7_BAD-04       WGRS--------PAPFGA-----ARARRPPTSGQHSAMAASSGG------
                                                                          

A0A2I2YVQ5_PMAIP1-      ----------------------------------
G3QIN5_BMF-02           ----------------------------------
G3QTJ6_HRK-01           ----------------------------------
G3QIN5_BMF-01           QHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2I2YQ13_BCL2L11      RLAKLLASST------------------------
A0A2I2YQ13_BCL2L11      RVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH-
A0A2I2YQ13_BCL2L11      ----------------------------------
A0A2I2YQ13_BCL2L11      ----------------------------------
A0A2I2YQ13_BCL2L11      ----------------------------------
A0A2I2YQ13_BCL2L11      RVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH-
A0A2I2YQ13_BCL2L11      RMPLPPD---------------------------
A0A2I2YQ13_BCL2L11      RLEK------------------------------
A0A2I2YQ13_BCL2L11      LNHKDFS---------------------------
A0A2I2YQ13_BCL2L11      --HREVQWPLEWLAKSS-----------------
A0A2I2YVQ5_PMAIP1-      ----ALGNGRWNTSK-------------------
G3QCT2_BIK-01           LLLPLLSGGLHLLLK-------------------
A0A2I2Z8C7_BAD-01       WWDRNLGRGSSAPSQ-------------------
A0A2I2Z8C7_BAD-02       WWDRNLGRGSSAPSQ-------------------
A0A2I2Z8C7_BAD-03       ----------------------------------
A0A2I2Z8C7_BAD-04       ----------------------------------
                                                          

© 1998-2018