Dataset for protein classical BH3-containing proteins of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YVQ5_PMAIP1-      ---MPGKKARKNAQPSPARAPAE---------------------------
G3QIN5_BMF-02           --MEPSQCVEELEDD--VFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSR
G3QTJ6_HRK-01           MCPCPLHRGRG---------------------------------------
G3QIN5_BMF-01           --MEPSQCVEELEDD--VFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSR
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2YVQ5_PMAIP1-      ---MPGKKARKNAQPSPARAPAG---------------------------
G3QCT2_BIK-01           MSEVRPLSRDILMETLLYEQLLE---------------------------
A0A2I2Z8C7_BAD-03       MFQIPEFEPSEQEDSSSAERGLG---------------------------
A0A2I2Z8C7_BAD-04       MFQIPEFEPSEQEDSSSAERGLG---------------------------
A0A2I2Z8C7_BAD-02       MFQIPEFEPSEQEDSSSAERGLG---------------------------
A0A2I2Z8C7_BAD-01       MFQIPEFEPSEQEDSSSAERGLG---------------------------
                                                                          

A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
G3QIN5_BMF-02           LQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLF
G3QTJ6_HRK-01           ----PPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSR
G3QIN5_BMF-01           LQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR--
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2I2YQ13_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2I2YVQ5_PMAIP1-      ----PAGTARDQAGFGIEMQLRFTRGKKLLSSSPLALPRGHEEQVQVAGS
G3QCT2_BIK-01           ----PPTME--------------------------VLGVTDSEEDLDPME
A0A2I2Z8C7_BAD-03       ----PSPAGDGPSG----------SGKHHRQAPGLLWDASHQQEQPTSSS
A0A2I2Z8C7_BAD-04       ----PSPAGDGPSG----------SGKHHRQAPGLLWDASHQQEQPTSSS
A0A2I2Z8C7_BAD-02       ----PSPAGDGPSG----------SGKHHRQAPGLLWDASHQQEQPTSSS
A0A2I2Z8C7_BAD-01       ----PSPAGDGPSG----------SGKHHRQAPGLLWDASHQQEQPTSSS
                                                                          

A0A2I2YVQ5_PMAIP1-      ----------------------------------LEVECATQLRRFGDKL
G3QIN5_BMF-02           Y----------------------APAEPKSCVVADPPLPAQPCFEWRREQ
G3QTJ6_HRK-01           R----------------------APAPGALPTYWPWLCAAAQVAALAAWL
G3QIN5_BMF-01           ----------LFYGNAGYRLPLPASFPAVLPIGE-----QPPEGQWQH--
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      -----------------------DRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2YQ13_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2YQ13_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2YQ13_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2YQ13_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2YQ13_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2YQ13_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2YQ13_BCL2L11      -----------------------DRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2YQ13_BCL2L11      -----------------------DRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2YVQ5_PMAIP1-      RVCY------------------STQEIWRQTELPAETSESDIQTLLLRNL
G3QCT2_BIK-01           DFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFI
A0A2I2Z8C7_BAD-03       HHGE--------------GTSSPEERRHSNADAAKLQLDASLPVLVGSEL
A0A2I2Z8C7_BAD-04       HHGG---------RTSYSPSWESED--SENPSAGMLAEASAGMSAPAADS
A0A2I2Z8C7_BAD-02       HHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQR
A0A2I2Z8C7_BAD-01       HHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQR
                                                                          

A0A2I2YVQ5_PMAIP1-      NFRQKLLNLISKLFCSGT--------------------------------
G3QIN5_BMF-02           ERGRP---------------------------------------------
G3QTJ6_HRK-01           LGRRNL--------------------------------------------
G3QIN5_BMF-01           --------------RAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQI
A0A2I2YQ13_BCL2L11      ---ASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKLLASST---
A0A2I2YQ13_BCL2L11      SAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDH
A0A2I2YQ13_BCL2L11      SAMVREIEEVVV--------------------------------------
A0A2I2YQ13_BCL2L11      SAMGIFE-------------------------------------------
A0A2I2YQ13_BCL2L11      SAMANWD-------------------------------------------
A0A2I2YQ13_BCL2L11      SAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDH
A0A2I2YQ13_BCL2L11      SAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK---------
A0A2I2YQ13_BCL2L11      SAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRMPLPPD------
A0A2I2YQ13_BCL2L11      SAMVVILEDIGDLSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS------
A0A2I2YQ13_BCL2L11      SAM----DDSAGSSLRIAL--------------------HREVQWPLEWL
A0A2I2YVQ5_PMAIP1-      TASKTCMRGLLQKSF-----------LRRCTFHQFEERLHCNWEECEGAF
G3QCT2_BIK-01           YDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPG------SWVSREQVL
A0A2I2Z8C7_BAD-03       GQG--KLRPLPVTFA----------AHPETPPVPTALGSHLEYGRKY--F
A0A2I2Z8C7_BAD-04       EAQ--HAENVKLEALGLW---RSGVA---TAPTPRGRRTTKGWGRSPAPF
A0A2I2Z8C7_BAD-02       YGR--ELRRMSDEFVDSF---KKGLPRPKSAGTATQMRQSSSWTRVFQSW
A0A2I2Z8C7_BAD-01       YGR--ELRRMSDEFVDSF---KKGLPRPKSAGTATQMRQSSSWTRVFQSW
                                                                          

A0A2I2YVQ5_PMAIP1-      --------------------------
G3QIN5_BMF-02           --------------------------
G3QTJ6_HRK-01           --------------------------
G3QIN5_BMF-01           LLFLHNLALNGEENRNGAGPR-----
A0A2I2YQ13_BCL2L11      --------------------------
A0A2I2YQ13_BCL2L11      PRMVILRLLRYIVRLVWRMH------
A0A2I2YQ13_BCL2L11      --------------------------
A0A2I2YQ13_BCL2L11      --------------------------
A0A2I2YQ13_BCL2L11      --------------------------
A0A2I2YQ13_BCL2L11      PRMVILRLLRYIVRLVWRMH------
A0A2I2YQ13_BCL2L11      --------------------------
A0A2I2YQ13_BCL2L11      --------------------------
A0A2I2YQ13_BCL2L11      --------------------------
A0A2I2YQ13_BCL2L11      AKSS----------------------
A0A2I2YVQ5_PMAIP1-      MGALGNGRWNTSK-------------
G3QCT2_BIK-01           LALLLLLALLLPLLSGGLHLLLK---
A0A2I2Z8C7_BAD-03       PQAYAKRGSVLSPLEGRLTQIPFRCV
A0A2I2Z8C7_BAD-04       GAARARRPPTSGQHSAMAASSGG---
A0A2I2Z8C7_BAD-02       WDRNLGRGSSAPSQ------------
A0A2I2Z8C7_BAD-01       WDRNLGRGSSAPSQ------------
                                                  

© 1998-2019