Dataset for protein classical BH3-containing proteins of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YVQ5_PMAIP1-      MPGKKARKNAQPSPARAPAELEVECATQLRRFGD----------------
G3QIN5_BMF-02           -----------------MEPSQCVEELEDDVFQP----------------
G3QIN5_BMF-01           -----------------MEPSQCVEELEDDVFQP----------------
G3QTJ6_HRK-01           ---------MCPCPLHRGRGPPAVCACSAGRLGL----------------
A0A2I2YQ13_BCL2L11      -------------MAKQPSDVSSECDREGRQLQP----------------
A0A2I2YQ13_BCL2L11      -------------MAKQPSDVSSECDREGRQLQP----------------
A0A2I2YQ13_BCL2L11      -------------MAKQPSDVSSECDREGRQLQP----------------
A0A2I2YQ13_BCL2L11      -------------MAKQPSDVSSECDREGRQLQP----------------
A0A2I2YQ13_BCL2L11      -------------MAKQPSDVSSECDREGRQLQP----------------
A0A2I2YQ13_BCL2L11      -------------MAKQPSDVSSECDREGRQLQP----------------
A0A2I2YQ13_BCL2L11      -------------MAKQPSDVSSECDREGRQLQP----------------
A0A2I2YQ13_BCL2L11      -------------MAKQPSDVSSECDREGRQLQP----------------
A0A2I2YQ13_BCL2L11      -------------MAKQPSDVSSECDREGRQLQP----------------
A0A2I2YQ13_BCL2L11      -------------MAKQPSDVSSECDREGRQLQP----------------
A0A2I2YVQ5_PMAIP1-      -------------MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIEMQL
G3QCT2_BIK-01           ----------MSEVRPLSRDILMETLLYEQLLEPPTME------------
A0A2I2Z8C7_BAD-03       ----------MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSG-------
A0A2I2Z8C7_BAD-04       ----------MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSG-------
A0A2I2Z8C7_BAD-02       ----------MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSG-------
A0A2I2Z8C7_BAD-01       ----------MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSG-------
                                                                          

A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
G3QIN5_BMF-02           ---EDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTS
G3QIN5_BMF-01           ---EDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTS
G3QTJ6_HRK-01           ---RSSAAQLTAARLKA----LGDELHQRTMWRRRARSRRAPAPGALPTY
A0A2I2YQ13_BCL2L11      ---AERPPQLRPGAPTS----LQTEPQ-----------------------
A0A2I2YQ13_BCL2L11      ---AERPPQLRPGAPTS----LQTEPQ-----------------------
A0A2I2YQ13_BCL2L11      ---AERPPQLRPGAPTS----LQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2I2YQ13_BCL2L11      ---AERPPQLRPGAPTS----LQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2I2YQ13_BCL2L11      ---AERPPQLRPGAPTS----LQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2I2YQ13_BCL2L11      ---AERPPQLRPGAPTS----LQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2I2YQ13_BCL2L11      ---AERPPQLRPGAPTS----LQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2I2YQ13_BCL2L11      ---AERPPQLRPGAPTS----LQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2I2YQ13_BCL2L11      ---AERPPQLRPGAPTS----LQTEPQ-----------------------
A0A2I2YQ13_BCL2L11      ---AERPPQLRPGAPTS----LQTEPQ-----------------------
A0A2I2YVQ5_PMAIP1-      RFTRGKKLLSSSPLALP----RGHEEQVQVAGSRVCY-------------
G3QCT2_BIK-01           --------------VLG----VTDSEEDLDPMEDFDSLECMEGSDALALR
A0A2I2Z8C7_BAD-03       ---SGKHHRQAPGLLWD----ASHQQEQPTSSSHHGE-------------
A0A2I2Z8C7_BAD-04       ---SGKHHRQAPGLLWD----ASHQQEQPTSSSHHGG---------RTSY
A0A2I2Z8C7_BAD-02       ---SGKHHRQAPGLLWD----ASHQQEQPTSSSHHGGAGAVEIRSRHSSY
A0A2I2Z8C7_BAD-01       ---SGKHHRQAPGLLWD----ASHQQEQPTSSSHHGGAGAVEIRSRHSSY
                                                                          

A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
G3QIN5_BMF-02           QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCVVADPPL--
G3QIN5_BMF-01           QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVL
G3QTJ6_HRK-01           WPWLCAAAQVAALAAWLLGRRNL---------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      -------------------------------------DRSPAPMSCDKST
A0A2I2YQ13_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKST
A0A2I2YQ13_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKST
A0A2I2YQ13_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKST
A0A2I2YQ13_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKST
A0A2I2YQ13_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKST
A0A2I2YQ13_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKST
A0A2I2YQ13_BCL2L11      -------------------------------------DRSPAPMSCDKST
A0A2I2YQ13_BCL2L11      -------------------------------------DRSPAPMSCDKST
A0A2I2YVQ5_PMAIP1-      -----STQEIWRQTELPAETSESDI------------QTLLLRNLTASKT
G3QCT2_BIK-01           LACIGDEMDVSLRAPRLAQLSEVAM------------HSLGLAFIYDQTE
A0A2I2Z8C7_BAD-03       -GTSSPEERRHSNADAAKLQLDASL------------PVLVGSELGQG--
A0A2I2Z8C7_BAD-04       SPSWESED--SENPSAGMLAEASAG------------MSAPAADSEAQ--
A0A2I2Z8C7_BAD-02       PAGTEDDEGMGEEPSPFRGRSRSAP------------PNLWAAQRYGR--
A0A2I2Z8C7_BAD-01       PAGTEDDEGMGEEPSPFRGRSRSAP------------PNLWAAQRYGR--
                                                                          

A0A2I2YVQ5_PMAIP1-      --------KLNFRQKLLNLISKLFCSGT----------------------
G3QIN5_BMF-02           -----PAQPCFEWRREQERGRP----------------------------
G3QIN5_BMF-01           PIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQIL
G3QTJ6_HRK-01           --------------------------------------------------
A0A2I2YQ13_BCL2L11      -----------------ASMRQAEPADMRPEIWIAQELRRIGDEFNAYYA
A0A2I2YQ13_BCL2L11      QTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYA
A0A2I2YQ13_BCL2L11      QTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYA
A0A2I2YQ13_BCL2L11      QTPSPPCQAFNHYLSAMVREIEEVVV------------------------
A0A2I2YQ13_BCL2L11      QTPSPPCQAFNHYLSAMGIFE-----------------------------
A0A2I2YQ13_BCL2L11      QTPSPPCQAFNHYLSAMANWD-----------------------------
A0A2I2YQ13_BCL2L11      QTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYA
A0A2I2YQ13_BCL2L11      QTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYA
A0A2I2YQ13_BCL2L11      QTPSPPCQAFNHYLSAMVVILEDIGDLSLWFGFIFTGLDLYGHHHSQDTE
A0A2I2YQ13_BCL2L11      QTPSPPCQAFNHYLSAM----DDSAGSSLRIAL-----------------
A0A2I2YVQ5_PMAIP1-      CMRGLLQKSF-----------LRRCTFHQFEERLHCNWEECEGAFMGALG
G3QCT2_BIK-01           DIRDVLRSFMDGFTTLKENIMRFWRSPNPG------SWVSREQVLLALLL
A0A2I2Z8C7_BAD-03       KLRPLPVTFA----------AHPETPPVPTALGSHLEYGRKY--FPQAYA
A0A2I2Z8C7_BAD-04       HAENVKLEALGLW---RSGVA---TAPTPRGRRTTKGWGRSPAPFGAARA
A0A2I2Z8C7_BAD-02       ELRRMSDEFVDSF---KKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNL
A0A2I2Z8C7_BAD-01       ELRRMSDEFVDSF---KKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNL
                                                                          

A0A2I2YVQ5_PMAIP1-      ----------------------------------
G3QIN5_BMF-02           ----------------------------------
G3QIN5_BMF-01           LFLHNLALNGEENRNGAGPR--------------
G3QTJ6_HRK-01           ----------------------------------
A0A2I2YQ13_BCL2L11      RRLAKLLASST-----------------------
A0A2I2YQ13_BCL2L11      RRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
A0A2I2YQ13_BCL2L11      RRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
A0A2I2YQ13_BCL2L11      ----------------------------------
A0A2I2YQ13_BCL2L11      ----------------------------------
A0A2I2YQ13_BCL2L11      ----------------------------------
A0A2I2YQ13_BCL2L11      RRMPLPPD--------------------------
A0A2I2YQ13_BCL2L11      RRLEK-----------------------------
A0A2I2YQ13_BCL2L11      QLNHKDFS--------------------------
A0A2I2YQ13_BCL2L11      ---HREVQWPLEWLAKSS----------------
A0A2I2YVQ5_PMAIP1-      NGRWNTSK--------------------------
G3QCT2_BIK-01           LLALLLPLLSGGLHLLLK----------------
A0A2I2Z8C7_BAD-03       KRGSVLSPLEGRLTQIPFRCV-------------
A0A2I2Z8C7_BAD-04       RRPPTSGQHSAMAASSGG----------------
A0A2I2Z8C7_BAD-02       GRGSSAPSQ-------------------------
A0A2I2Z8C7_BAD-01       GRGSSAPSQ-------------------------
                                                          

© 1998-2019