Dataset for protein Bmf of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3QIN5_BMF-01      MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
G3QIN5_BMF-02      MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
                   ************************************************************

G3QIN5_BMF-01      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
G3QIN5_BMF-02      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCVVADPPL-------P
                   *************************************. *  .  : *. *        *

G3QIN5_BMF-01      PEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG
G3QIN5_BMF-02      AQPCFEWRREQERGRP--------------------------------------------
                   .:  ::.* * : .*                                             

G3QIN5_BMF-01      AGPR
G3QIN5_BMF-02      ----
                       

© 1998-2018