Dataset for protein Bim of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                        *****************************************         

A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2YQ13_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2YQ13_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2YQ13_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2YQ13_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2YQ13_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
                                                                          

A0A2I2YQ13_BCL2L11      -------------------------------ASMRQAEPADMRPEIWIAQ
A0A2I2YQ13_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
A0A2I2YQ13_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
A0A2I2YQ13_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
A0A2I2YQ13_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
A0A2I2YQ13_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
A0A2I2YQ13_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD---------------
A0A2I2YQ13_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE---------------
A0A2I2YQ13_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDLSLWFGFIFT
A0A2I2YQ13_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM----DDSAGSSLRIAL---
                                                                          

A0A2I2YQ13_BCL2L11      ELRRIGDEFNAYYARRLAKLLASST-----------------------
A0A2I2YQ13_BCL2L11      ELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
A0A2I2YQ13_BCL2L11      ELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
A0A2I2YQ13_BCL2L11      ELRRIGDEFNAYYARRLEK-----------------------------
A0A2I2YQ13_BCL2L11      ELRRIGDEFNAYYARRMPLPPD--------------------------
A0A2I2YQ13_BCL2L11      ------------------------------------------------
A0A2I2YQ13_BCL2L11      ------------------------------------------------
A0A2I2YQ13_BCL2L11      ------------------------------------------------
A0A2I2YQ13_BCL2L11      GLDLYGHHHSQDTEQLNHKDFS--------------------------
A0A2I2YQ13_BCL2L11      -----------------HREVQWPLEWLAKSS----------------
                                                                        

© 1998-2018