Dataset for protein classical BH3-containing proteins of organism Gopherus agassizii

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452J430_PMAIP1-      --------------------------------------------------
A0A452H3N6_BMF-01       MDPPNYLEDDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCL
A0A452IFQ4_BAD-01       ----------MFRIQEFPDEVF------PGRGKEAPAPPESQRGHT----
                                                                          

A0A452J430_PMAIP1-      -----------------------------------------------MPG
A0A452H3N6_BMF-01       LGRFQLFPLTHCCGPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEEPQ
A0A452IFQ4_BAD-01       --------------PG---SKQPDTPTAEVRSRIGSDTPSLEPEVQDEPG
                                                                        * 

A0A452J430_PMAIP1-      KTLRKGAQQNPALPAQE-------------------AVTQCSLQLRKIGD
A0A452H3N6_BMF-01       RLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREALAEVQIARKLQCIAD
A0A452IFQ4_BAD-01       GAFRARSR---SAPPILW------------------AAMRYGRELRRMSD
                          :   :      *.                     *  . . :*. :.*

A0A452J430_PMAIP1-      ICNLQQKILNVITKLFCPGT------------------------------
A0A452H3N6_BMF-01       QFH---------RLHIQRHQQNRNQVWWQILLFIHNLALNVEVNRNHVGQ
A0A452IFQ4_BAD-01       EFDVALQVLPRPKSAGTTSQLHRGNSWKETL-------------QAWLGH
                                                                          

A0A452J430_PMAIP1-      ------------
A0A452H3N6_BMF-01       R-----------
A0A452IFQ4_BAD-01       RPARDALPRSSK
                                    

© 1998-2019