Dataset for protein classical BH3-containing proteins of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1D5PAR2_PMAIP1-      ---------------------------MMPGR------------------
A9XRH0_BMF-01           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNA-----------------
A9XRG9_BMF-01           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A9XRG9_BMF-02           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A9XRG9_BMF-03           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                                                    :.*.                  

A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
A9XRG9_BMF-01           LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A9XRG9_BMF-02           LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A9XRG9_BMF-03           LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                                                                          

A0A1D5PAR2_PMAIP1-      ------------------TIRKPAPPAAPAERDAVAECALELRRIGDKAD
A9XRH0_BMF-01           ------------------GYRLHVPPVGFALDPNLQEEPQEGQREARTEV
A9XRG9_BMF-01           RRLFYGKSTPTSPAFQQGNYPFSTSPVRQFLSLKL---------------
A9XRG9_BMF-02           RRLFYGNA----------GYRLHVPPVGFALDPNLQEEPQEGQREARTEV
A9XRG9_BMF-03           RRLFYGNA----------GYRLHVPPVGFALDPNLQEEPQEGQREARTEV
                                               ..*.       :               

A0A1D5PAR2_PMAIP1-      LQQKVLNLITKLFCPKT---------------------------------
A9XRH0_BMF-01           QIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRT
A9XRG9_BMF-01           --------------------------------------------------
A9XRG9_BMF-02           QIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRT
A9XRG9_BMF-03           QIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRT
                                                                          

A0A1D5PAR2_PMAIP1-      ---
A9XRH0_BMF-01           GQR
A9XRG9_BMF-01           ---
A9XRG9_BMF-02           GQR
A9XRG9_BMF-03           GQR
                           

© 1998-2019