Dataset for protein classical BH3-containing proteins of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A9XRH0_BMF-01           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA--------------------
A9XRG9_BMF-02           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A9XRG9_BMF-01           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A9XRG9_BMF-03           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A9XRG9_BMF-04           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                                                                          

A0A1D5PAR2_PMAIP1-      -----------MMPGRTIRKP-----------------------------
A9XRH0_BMF-01           --------------------------------------------------
A9XRG9_BMF-02           LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A9XRG9_BMF-01           LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A9XRG9_BMF-03           LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A9XRG9_BMF-04           LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                                                                          

A0A1D5PAR2_PMAIP1-      -------------APPAA----PAERDAVAECALELRRIGDKADLQQKVL
A9XRH0_BMF-01           -----GNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A9XRG9_BMF-02           RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A9XRG9_BMF-01           RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A9XRG9_BMF-03           RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A9XRG9_BMF-04           RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
                                     .**..    *  .:   *   * *   : *   * : 

A0A1D5PAR2_PMAIP1-      NLITKLFCPKT---------------------------------------
A9XRH0_BMF-01           DQFHRLHIQRHQQNRNQVWWQLFLFL------HNLALNVEANRNRTGQR-
A9XRG9_BMF-02           DQFHRLHIQRVGCFHRGRWGLSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ
A9XRG9_BMF-01           DQFHRLHIQRVGCFHRGRWGLSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ
A9XRG9_BMF-03           DQFHRLHIQRHQQNRNQVWWQLFLFL------HNLALNVEANRNRTGQR-
A9XRG9_BMF-04           DQFHRLHIQRHQQNRNQVWWQLFLFL------HNLALNVEANRNRTGQR-
                        : : .*.  .                                        

© 1998-2019