Dataset for protein classical BH3-containing proteins of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A9XRH0_BMF-01           ------------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAG-------
A0A3Q2U844_BCL2L11      MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPASPGS
A9XRG9_BMF-03           ------------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTA
A9XRG9_BMF-04           ------------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTA
A9XRG9_BMF-01           ------------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTA
A9XRG9_BMF-02           ------------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTA
                                                                          

A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
A0A3Q2U844_BCL2L11      PGPFAIRSPLFFFVRRSPLLPRSSSGYFSFEAERSPAPMSCDKATQTPSP
A9XRG9_BMF-03           TGIFTQNQSYSCLLGRFQLFPLTHCC-----GPGVRHPEQQDKATQTLSP
A9XRG9_BMF-04           TGIFTQNQSYSCLLGRFQLFPLTHCC-----GPGVRHPEQQDKATQTLSP
A9XRG9_BMF-01           TGIFTQNQSYSCLLGRFQLFPLTHCC-----GPGVRHPEQQDKATQTLSP
A9XRG9_BMF-02           TGIFTQNQSYSCLLGRFQLFPLTHCC-----GPGVRHPEQQDKATQTLSP
                                                                          

A0A1D5PAR2_PMAIP1-      --------------------MMPGRTIRKPAPPAA----PAERDAVAECA
A9XRH0_BMF-01           -----------------------NAGYRLHVPPVGFALDPNLQEEPQEGQ
A0A3Q2U844_BCL2L11      ---------PCQAVSH----YLSAMASRWRSHSLAEEIQP----------
A9XRG9_BMF-03           SSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQ
A9XRG9_BMF-04           SSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQ
A9XRG9_BMF-01           SSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQ
A9XRG9_BMF-02           SSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQ
                                                   *    . .    *          

A0A1D5PAR2_PMAIP1-      LELRRIGDKADLQQKVLNLITKLFCPKT----------------------
A9XRH0_BMF-01           REARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFL------H
A0A3Q2U844_BCL2L11      -----EIWIAQELRRIGDEFNASYCPRRGFLDNRAGNPQVVILRLLHYII
A9XRG9_BMF-03           REARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFL------H
A9XRG9_BMF-04           REARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFL------H
A9XRG9_BMF-01           REARTEVQIARKLQCIADQFHRLHIQRVGCFHRGRWGLSYLRVVLQKTGS
A9XRG9_BMF-02           REARTEVQIARKLQCIADQFHRLHIQRVGCFHRGRWGLSYLRVVLQKTGS
                                 *   . : : :   .  .                       

A0A1D5PAR2_PMAIP1-      -----------------
A9XRH0_BMF-01           NLALNVEANRNRTGQR-
A0A3Q2U844_BCL2L11      RLIWRMQ----------
A9XRG9_BMF-03           NLALNVEANRNRTGQR-
A9XRG9_BMF-04           NLALNVEANRNRTGQR-
A9XRG9_BMF-01           RLRLSRLLPKAAAGYRQ
A9XRG9_BMF-02           RLRLSRLLPKAAAGYRQ
                                         

© 1998-2019