Dataset for protein classical BH3-containing proteins of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1D5PAR2_PMAIP1-      -------------------------------------------------M
A9XRG9_BMF-03           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A9XRG9_BMF-02           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A9XRG9_BMF-01           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A9XRH0_BMF-01           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNAGY---------------
                                                                          

A0A1D5PAR2_PMAIP1-      MPGRTIRKP-----APPAAPAERDAVAECALELRRIGDKADLQQKVLNLI
A9XRG9_BMF-03           LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A9XRG9_BMF-02           LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A9XRG9_BMF-01           LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A9XRH0_BMF-01           ---RLHVPPVGFALDPNLQEEPQEGQREARTEVQIARK---LQC-IADQF
                           *    *      *      .:       .     .   *   : :  

A0A1D5PAR2_PMAIP1-      TKLFCPKT------------------------------------------
A9XRG9_BMF-03           RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A9XRG9_BMF-02           RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A9XRG9_BMF-01           RRLFYG--------------------------------------------
A9XRH0_BMF-01           HRLHIQ--------------------------------------------
                         .*.                                              

A0A1D5PAR2_PMAIP1-      --------------------------------------------
A9XRG9_BMF-03           DQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR-
A9XRG9_BMF-02           DQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR-
A9XRG9_BMF-01           ---------KSTPTSPA------FQQGNYPFSTSPVRQFLSLKL
A9XRH0_BMF-01           ---------RHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR-
                                                                    

© 1998-2018