Dataset for protein Bmf of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A9XRH0_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA------------------------------
A9XRG9_BMF-02      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPL
A9XRG9_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPL
A9XRG9_BMF-03      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPL
A9XRG9_BMF-04      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPL
                   ******************************                              

A9XRH0_BMF-01      ---------------------------------------------GNAGYRLHVPPVGFA
A9XRG9_BMF-02      THCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFA
A9XRG9_BMF-01      THCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFA
A9XRG9_BMF-03      THCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFA
A9XRG9_BMF-04      THCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFA
                                                                ***************

A9XRH0_BMF-01      LDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFL----
A9XRG9_BMF-02      LDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRVGCFHRGRWGLSYLRVVLQK
A9XRG9_BMF-01      LDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRVGCFHRGRWGLSYLRVVLQK
A9XRG9_BMF-03      LDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFL----
A9XRG9_BMF-04      LDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFL----
                   ****************************************    ..  *   :* :    

A9XRH0_BMF-01      --HNLALNVEANRNRTGQR-
A9XRG9_BMF-02      TGSRLRLSRLLPKAAAGYRQ
A9XRG9_BMF-01      TGSRLRLSRLLPKAAAGYRQ
A9XRG9_BMF-03      --HNLALNVEANRNRTGQR-
A9XRG9_BMF-04      --HNLALNVEANRNRTGQR-
                      .* *.    .  :* * 

© 1998-2019