Dataset for protein Bmf of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A9XRH0_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNA---------------------------
A9XRG9_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPL
A9XRG9_BMF-02      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPL
A9XRG9_BMF-03      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPL
                   *******************************:.                           

A9XRH0_BMF-01      ----------------------------------------------------------GY
A9XRG9_BMF-01      THCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGKSTPTSPAFQQGNY
A9XRG9_BMF-02      THCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNA----------GY
A9XRG9_BMF-03      THCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNA----------GY
                                                                             .*

A9XRH0_BMF-01      RLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWW
A9XRG9_BMF-01      PFSTSPVRQFLSLKL---------------------------------------------
A9XRG9_BMF-02      RLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWW
A9XRG9_BMF-03      RLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQRHQQNRNQVWW
                    : ..**   *. :*                                             

A9XRH0_BMF-01      QLFLFLHNLALNVEANRNRTGQR
A9XRG9_BMF-01      -----------------------
A9XRG9_BMF-02      QLFLFLHNLALNVEANRNRTGQR
A9XRG9_BMF-03      QLFLFLHNLALNVEANRNRTGQR
                                          

© 1998-2018