Dataset for protein classical BH3-containing proteins of organism Fundulus heteroclitus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2PJX9_BMF-03       -------------------------MEDEEDDVFEPDPNCWRTPFREIKC
A0A3Q2PJX9_BMF-01       -------------------------MEDEEDDVFEPDPNCWRTPFREIKC
A0A3Q2PJX9_BMF-02       -------------------------MEDEEDDVFEPDPNCWRTPFREIKC
A0A3Q2QC80_BAD-01       MSPSSSSHIGCFPYPLRNQINSSPSCTFISGLNFPNSCLPDDTMAAKFTI
A0A3Q2SZH6_BCL2L11      ------MVTLCSSNRPPNLRDGSTEVTPPEGTGGDPASSARTPRLSKHR-
                                                     ..           .   :   

A0A3Q2PJX9_BMF-03       EDRGTQTPGPALAPNNGMLPCGVAEEPRQ--------------LFYGNAG
A0A3Q2PJX9_BMF-01       EDRGTQTPGPALAPNNGMLPCGVAEEPRQ--------------LFYGNAG
A0A3Q2PJX9_BMF-02       EDRGTQTPGPALAPNNGMLPCGVAEEPRQ--------------LFYGNAG
A0A3Q2QC80_BAD-01       SDSDSEPPEEVEEEGNDQPADGKVEPLRQRHALTL------PELRSGHGR
A0A3Q2SZH6_BCL2L11      EGSCAQPPGAVTAAGGGGGEPDSDSPPRSISPNSLDVFQRRSIFRKSSGY
                        ..  ::.*  .   ...    .  .  *.              :  . . 

A0A3Q2PJX9_BMF-03       FRLH---FPAHFELVGDFDARRQE--------------------------
A0A3Q2PJX9_BMF-01       FRLH---FPAHFELVGDFDARRQE--------------------------
A0A3Q2PJX9_BMF-02       FRLH---FPAHFELVGDFDARRQE--------------------------
A0A3Q2QC80_BAD-01       IRLNSESHASTISREEELQGRAEEEAGTPT--------------------
A0A3Q2SZH6_BCL2L11      FSFDCESLPSTPLSPHPLTADKATQTASPTGQVMNHALQRMAAEHGGQPA
                        : :     .:       : .                              

A0A3Q2PJX9_BMF-03       -----EQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQ-----
A0A3Q2PJX9_BMF-01       -----EQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQ-----
A0A3Q2PJX9_BMF-02       -----EQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQRGSFR
A0A3Q2QC80_BAD-01       -----EGLPFRNRSNSAPPALWAAKKYGRQLRRMSDEFGSLLDKGELR--
A0A3Q2SZH6_BCL2L11      RILGLHGHSFSARQGNAARDM-QPERFGRQLRAIGDEYNNHLMRMAGR--
                                 :       .  :      *.:*. :.*::     .      

A0A3Q2PJX9_BMF-03       ------------YHQNQRNQGPLWW------RMTAALLSLLLDRGFVAGR
A0A3Q2PJX9_BMF-01       ------------YHQNQRNQGPLWW------RMTAALLSLLLDRGFVAGR
A0A3Q2PJX9_BMF-02       SSLAAGEVGKPMYYTNVYSQCPTCWLANCLSRLAAELLILCEFPTLL---
A0A3Q2QC80_BAD-01       ------------KVSSAGTNRPIHHSRS-------------WWNYLFSHQ
A0A3Q2SZH6_BCL2L11      ------------QQRDMVPLNLMPHIQQEPVAMLCVGLLLLLIGRIMYLQ
                                       .        .                    :.   

A0A3Q2PJX9_BMF-03       GGAGRR-----------
A0A3Q2PJX9_BMF-01       GGAGRR-----------
A0A3Q2PJX9_BMF-02       -----------------
A0A3Q2QC80_BAD-01       ETEGENSHHENHAPRTE
A0A3Q2SZH6_BCL2L11      GSTNSHDHSQV------
                                         

© 1998-2019