Dataset for protein Bmf of organism Fundulus heteroclitus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2PJX9_BMF-03      MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAE
A0A3Q2PJX9_BMF-01      MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAE
A0A3Q2PJX9_BMF-02      MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAE
                       **************************************************

A0A3Q2PJX9_BMF-03      EPRQLFYGNAGFRLHFPAHFELVGDFDARRQEEQNRMEPLPLHQPAALSL
A0A3Q2PJX9_BMF-01      EPRQLFYGNAGFRLHFPAHFELVGDFDARRQEEQNRMEPLPLHQPAALSL
A0A3Q2PJX9_BMF-02      EPRQLFYGNAGFRLHFPAHFELVGDFDARRQEEQNRMEPLPLHQPAALSL
                       **************************************************

A0A3Q2PJX9_BMF-03      EACIGQKLQLIGDQFHREHLQQ-----------------YHQNQRNQGPL
A0A3Q2PJX9_BMF-01      EACIGQKLQLIGDQFHREHLQQ-----------------YHQNQRNQGPL
A0A3Q2PJX9_BMF-02      EACIGQKLQLIGDQFHREHLQQRGSFRSSLAAGEVGKPMYYTNVYSQCPT
                       **********************                 *: *  .* * 

A0A3Q2PJX9_BMF-03      WW------RMTAALLSLLLDRGFVAGRGGAGRR
A0A3Q2PJX9_BMF-01      WW------RMTAALLSLLLDRGFVAGRGGAGRR
A0A3Q2PJX9_BMF-02      CWLANCLSRLAAELLILCEFPTLL---------
                        *      *::* ** *     ::         

© 1998-2019