Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2UX96_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQ------
A0A2I2UX96_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQGNPEGE
A0A2I2UX96_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQGNPEGE
A0A2I2UX96_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQ------
A0A2I2UX96_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQGNPEGE
A0A2I2UX96_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQGNPEGE
M3WRS0_BMF-02           --MEPPQCVEELEDD--VFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSH
M3WRS0_BMF-01           --MEPPQCVEELEDD--VFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSH
                           :*.:  .* : :   :** :  *  .**:  *   :  .*       

A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATR-----SPFFIFVRRSSLLSRSSSGY
A0A2I2UX96_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATR-----SPFFIFVRRSSLLSRSSSGY
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATR-----SPFFIFVRRSSLLSRSSSGY
A0A2I2UX96_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATR-----SPFFIFVRRSSLLSRSSSGY
M3WRS0_BMF-02           LQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLF
M3WRS0_BMF-01           LQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLF
                                                                          

A0A2I2UX96_BCL2L11      -----------------------------------ASMRQPQAVPADMRP
A0A2I2UX96_BCL2L11      FSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEGVL------
A0A2I2UX96_BCL2L11      FSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM------GLFE-----
A0A2I2UX96_BCL2L11      -----DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRP
A0A2I2UX96_BCL2L11      FSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRP
A0A2I2UX96_BCL2L11      FSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRP
M3WRS0_BMF-02           YAPA----KPPSSVVADSPLPTQP---GFECRREQEWGRSQ---------
M3WRS0_BMF-01           YGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHR
                                                                          

A0A2I2UX96_BCL2L11      EIWIAQELRRIGDEFNAYYPRRLARVPASYI-------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      EIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLV
A0A2I2UX96_BCL2L11      EIWIAQELRRIGDEFNAYYPRRLEQ-------------------------
A0A2I2UX96_BCL2L11      EIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLV
M3WRS0_BMF-02           --------------------------------------------------
M3WRS0_BMF-01           LHMQQHQQNRRRVWWQILLFLHNLALNAEENRNGAGPR------------
                                                                          

A0A2I2UX96_BCL2L11      ----
A0A2I2UX96_BCL2L11      ----
A0A2I2UX96_BCL2L11      ----
A0A2I2UX96_BCL2L11      WRLQ
A0A2I2UX96_BCL2L11      ----
A0A2I2UX96_BCL2L11      WRLQ
M3WRS0_BMF-02           ----
M3WRS0_BMF-01           ----
                            

© 1998-2018