Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337SUX1_PMAIP1-      ----------------------------MPGKRTRKSA------------
A0A337SAW2_BAD-01       -MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLG
A0A337SQV0_BBC3-01      VYLSAGAARACPRQVPGASFFPGCPRE-RHGPSTPG---GQLPGARRGPG
A0A337SQ56_HRK-01       --------------------------------------------------
M3WRS0_BMF-01           --MEPPQCVEELEDD--VFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSH
A0A337SQV0_BBC3-03      ------------YLGGGGLGESCVCARARCVGVTP---------------
A0A337SQV0_BBC3-02      --------MARARQEGSSPEPVE---GLARDGPRP---FPLSRLVPSAVS
M3WRS0_BMF-02           --MEPPQCVEELEDD--VFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSH
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQ------
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQ------
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQGNPEGE
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQGNPEGE
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQGNPEGE
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQGNPEGE
                                                                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SAW2_BAD-01       RKRPRPLA--SPGDIS------KADWAGSVTVPVAQATRAGLPQYWREAA
A0A337SQV0_BBC3-01      PRRPAPLSPQPPGALGRVLRPLRARPARRPRRPRPAARRLPLRPHRPARR
A0A337SQ56_HRK-01       --------------------------------------------------
M3WRS0_BMF-01           LQLFPLTHCCGPGLRPTSQE------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
A0A337SQV0_BBC3-02      CGLCEPGLPAAPAAPALLPAAYLCAP-----TAPPAVTAALGGPRWPGGP
M3WRS0_BMF-02           LQLFPLTHCCGPGLRPTSQE------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDT
A0A337SW42_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDT
A0A337SW42_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDT
A0A337SW42_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDT
                                                                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SAW2_BAD-01       GPGQGPRDRAWAQSMFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGK
A0A337SQV0_BBC3-01      HRRPGGPPLAWGSPQ-PAPRAAPRRSSALTLAGRAAPGIAGAQRPGGPGG
A0A337SQ56_HRK-01       -MCPCPLHRGRGPPAVCACS------------------------------
M3WRS0_BMF-01           DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPL
A0A337SQV0_BBC3-03      -----WVCVACPQPSLSPAEQHLESPVPSAPG-----------ALAGGPT
A0A337SQV0_BBC3-02      RSRPRGPRPDGPQPSLSPAEQHLESPVPSAPG-----------ALAGGPT
M3WRS0_BMF-02           DKATQTLSPASPSQGVMLPCGVTEEPQRLFYA-----------PAKPPSS
A0A337SW42_BCL2L11      ------------------------------------------------AS
A0A337SW42_BCL2L11      DRSPAPMSCDKSTQTPSPPC-------QAFNH-----------YLSAMAS
A0A337SW42_BCL2L11      DRSPAPMSCDKSTQTPSPPC-------QAFNH-----------YLSAM--
A0A337SW42_BCL2L11      DRSPAPMSCDKSTQTPSPPC-------QAFNH-----------YLSAMVR
A0A337SW42_BCL2L11      DRSPAPMSCDKSTQTPSPPC-------QAFNH-----------YLSAMAS
A0A337SW42_BCL2L11      DRSPAPMSCDKSTQTPSPPC-------QAFNH-----------YLSAMAS
                                                                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SAW2_BAD-01       HQRTTPGLLGEAGHQQGQPASSNHHGGAGAVETRSRHSSYPAGTEEDEGT
A0A337SQV0_BBC3-01      RP---------------HPGSPGSPGGGGAVGPGDRGPAAADGGRPQRAV
A0A337SQ56_HRK-01       --------------------------------------------------
M3WRS0_BMF-01           GE------------------------------------------------
A0A337SQV0_BBC3-03      QA------------------------------------------------
A0A337SQV0_BBC3-02      QA------------------------------------------------
M3WRS0_BMF-02           VV------------------------------------------------
A0A337SW42_BCL2L11      MR------------------------------------------------
A0A337SW42_BCL2L11      MR------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      AI------------------------------------------------
A0A337SW42_BCL2L11      MR------------------------------------------------
A0A337SW42_BCL2L11      MR------------------------------------------------
                                                                          

A0A337SUX1_PMAIP1-      ----------QPSPARAPAEPEVECAMQLRRFGDKLNFRQKLMNLISKLF
A0A337SAW2_BAD-01       EEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFKGLP-----R
A0A337SQV0_BBC3-01      RAAET---RGAAATPPLTLEGPVQSHHGTPALTQGPRGPGDGAQLGACTR
A0A337SQ56_HRK-01       -----------AGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRR
M3WRS0_BMF-01           ----------QPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRR
A0A337SQV0_BBC3-03      ----------APGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQR
A0A337SQV0_BBC3-02      ----------APGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQR
M3WRS0_BMF-02           ----------ADSPLPTQPGFECRREQEWGRSQ-----------------
A0A337SW42_BCL2L11      ----------QPQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLARVPAS
A0A337SW42_BCL2L11      ----------QPQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQ
A0A337SW42_BCL2L11      ------------GLFE----------------------------------
A0A337SW42_BCL2L11      ----------EEGVL-----------------------------------
A0A337SW42_BCL2L11      ----------QPQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLEQ----
A0A337SW42_BCL2L11      ----------QPQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQ
                                                                          

A0A337SUX1_PMAIP1-      RSGT---------------------------------
A0A337SAW2_BAD-01       PKSAGTATQMRQSPSWTRFIQSWWDRNLGRGGSAPSQ
A0A337SQV0_BBC3-01      PVDVGDLGGRTLPPP---------DALASAGDFFCTM
A0A337SQ56_HRK-01       APAPGALPTYWPWLCAAAQVAALAAWLLGRRNL----
M3WRS0_BMF-01           VWWQILLFLHNLALNAEENRNGAGPR-----------
A0A337SQV0_BBC3-03      HRPSPWRVLYNLIMGLLPLPRARGAPEMEPN------
A0A337SQV0_BBC3-02      HRPSPWRVLYNLIMGLLPLPRARGAPEMEPN------
M3WRS0_BMF-02           -------------------------------------
A0A337SW42_BCL2L11      YI-----------------------------------
A0A337SW42_BCL2L11      AAEAQPQMIILRLLRYIVRLVWRLQ------------
A0A337SW42_BCL2L11      -------------------------------------
A0A337SW42_BCL2L11      -------------------------------------
A0A337SW42_BCL2L11      -------------------------------------
A0A337SW42_BCL2L11      AAEAQPQMIILRLLRYIVRLVWRLQ------------
                                                             

© 1998-2019