Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337SAW2_BAD-01       MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SQV0_BBC3-03      -----------------------------------------YLGGGGLGE
M3WRS0_BMF-02           -------------------------------MEPPQCVEE--LEDDVFQP
M3WRS0_BMF-01           -------------------------------MEPPQCVEE--LEDDVFQP
A0A337SQV0_BBC3-02      -----------------------------MARARQEGSSP-EPVEGLARD
A0A337SW42_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A337SW42_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A337SW42_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A337SW42_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A337SW42_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A337SQ56_HRK-01       ----------------------MCPCPLHRGRGPPAV---CACSAGRLGL
A0A337SW42_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
                                                                          

A0A337SAW2_BAD-01       KRPRPLASPGDISKADWAGSVTVPVAQATRAGLPQYWREAAGPGQGPRDR
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SQV0_BBC3-03      SCVCARARCV--------GVT-------------------------PWVC
M3WRS0_BMF-02           EDVEPGTQPG--------SLLSANLFAQSQLD-----CPLSHLQLFPLTH
M3WRS0_BMF-01           EDVEPGTQPG--------SLLSANLFAQSQLD-----CPLSHLQLFPLTH
A0A337SQV0_BBC3-02      GPRPFPLSRL--------VPSAVSC----------GLCEPGLPAA-PAAP
A0A337SW42_BCL2L11      AERPPQLRPG--------APTSLQTEQQ----------------------
A0A337SW42_BCL2L11      AERPPQLRPG--------APTSLQTEQQGNPEGEGDRCPQGSPQG-PLAP
A0A337SW42_BCL2L11      AERPPQLRPG--------APTSLQTEQQGNPEGEGDRCPQGSPQG-PLAP
A0A337SW42_BCL2L11      AERPPQLRPG--------APTSLQTEQQGNPEGEGDRCPQGSPQG-PLAP
A0A337SW42_BCL2L11      AERPPQLRPG--------APTSLQTEQQGNPEGEGDRCPQGSPQG-PLAP
A0A337SQ56_HRK-01       RSSAAQLTAA--------RLKALGDELH----------------------
A0A337SW42_BCL2L11      AERPPQLRPG--------APTSLQTEQQ----------------------
                                                                          

A0A337SAW2_BAD-01       AWAQSMFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTTPGLL
A0A337SUX1_PMAIP1-      ------------------------------------------------MP
A0A337SQV0_BBC3-03      VACPQPSL----------------------------------------SP
M3WRS0_BMF-02           CCGPGLRPT---------------------------------------SQ
M3WRS0_BMF-01           CCGPGLRPT---------------------------------------SQ
A0A337SQV0_BBC3-02      ALLPAAYLCAPTAPPAVTAALGGPRWPGG--PRSRPRGPRPDGPQPSLSP
A0A337SW42_BCL2L11      -----------------------------------DRSPAP-------MS
A0A337SW42_BCL2L11      PASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAP-------MS
A0A337SW42_BCL2L11      PASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAP-------MS
A0A337SW42_BCL2L11      PASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAP-------MS
A0A337SW42_BCL2L11      PASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAP-------MS
A0A337SQ56_HRK-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
                                                                          

A0A337SAW2_BAD-01       GEAGHQQGQPASSNHHGGAGAVETRSRHSSY--PAGTEEDEGTEEEEPSP
A0A337SUX1_PMAIP1-      GKRTRKSAQPSPA-------------------------------------
A0A337SQV0_BBC3-03      AEQHLESPVPSAPGA---LAGGPTQAAPGVR-------------------
M3WRS0_BMF-02           EDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA----KPPSSVVADSP
M3WRS0_BMF-01           EDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLP
A0A337SQV0_BBC3-02      AEQHLESPVPSAPGA---LAGGPTQAAPGVR-------------------
A0A337SW42_BCL2L11      CDKSTQTPSPPCQAFNHYLSAMASMRQPQAV-------------------
A0A337SW42_BCL2L11      CDKSTQTPSPPCQAFNHYLSAM------GLF-------------------
A0A337SW42_BCL2L11      CDKSTQTPSPPCQAFNHYLSAMVRAIEEGVL-------------------
A0A337SW42_BCL2L11      CDKSTQTPSPPCQAFNHYLSAMASMRQPQAV-------------------
A0A337SW42_BCL2L11      CDKSTQTPSPPCQAFNHYLSAMASMRQPQAV-------------------
A0A337SQ56_HRK-01       --------------------------------------------------
A0A337SW42_BCL2L11      ----------------------ASMRQPQAV-------------------
                                                                          

A0A337SAW2_BAD-01       FRGRSRSAPPNLWAALRYGRELRRMS---DEFQGSFKGLPRPKSAGTATQ
A0A337SUX1_PMAIP1-      --------RAPAEPEVECAMQLRRFG---DKLNFRQKLMNLISKLFRSGT
A0A337SQV0_BBC3-03      --------GEEEQWAREIGAQLRRMA---DDLNALYERRRQEEQQRHRPS
M3WRS0_BMF-02           LPTQP---GFECRREQEWGRSQ----------------------------
M3WRS0_BMF-01           LGEQPPEGHWQHRAEVQIARKLQCIA---DQFHRLHMQQHQQNRRRVWWQ
A0A337SQV0_BBC3-02      --------GEEEQWAREIGAQLRRMA---DDLNALYERRRQEEQQRHRPS
A0A337SW42_BCL2L11      --------PADMRPEIWIAQELRRIG---DEFNAYYPRRVFLNNYQAAEA
A0A337SW42_BCL2L11      --------E-----------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------PADMRPEIWIAQELRRIG---DEFNAYYPRRLEQ--------
A0A337SW42_BCL2L11      --------PADMRPEIWIAQELRRIG---DEFNAYYPRRVFLNNYQAAEA
A0A337SQ56_HRK-01       ------------QRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAA
A0A337SW42_BCL2L11      --------PADMRPEIWIAQELRRIG---DEFNAYYPRRLARVPASYI--
                                                                          

A0A337SAW2_BAD-01       MRQSPSWTRFIQSWWDRNLGRGGSAPSQ
A0A337SUX1_PMAIP1-      ----------------------------
A0A337SQV0_BBC3-03      PWRVLYNLIMGLLPLPRARGAPEMEPN-
M3WRS0_BMF-02           ----------------------------
M3WRS0_BMF-01           ILLFLHNLALNAEENRNGAGPR------
A0A337SQV0_BBC3-02      PWRVLYNLIMGLLPLPRARGAPEMEPN-
A0A337SW42_BCL2L11      QPQMIILRLLRYIVRLVWRLQ-------
A0A337SW42_BCL2L11      ----------------------------
A0A337SW42_BCL2L11      ----------------------------
A0A337SW42_BCL2L11      ----------------------------
A0A337SW42_BCL2L11      QPQMIILRLLRYIVRLVWRLQ-------
A0A337SQ56_HRK-01       WLLGRRNL--------------------
A0A337SW42_BCL2L11      ----------------------------
                                                    

© 1998-2019