Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SAW2_BAD-01       -MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLG
A0A337SQV0_BBC3-01      VYLSAGAARACPRQVPGASFFPGCPRE-RHGPSTPG---GQLPGARRGPG
A0A337SQ56_HRK-01       --------------------------------------------------
A0A337SQV0_BBC3-03      ------------YLGGGGLGESCVCARARCVGVTPWVCVAC---------
M3WRS0_BMF-02           --MEPPQCVEE--LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-------
M3WRS0_BMF-01           --MEPPQCVEE--LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-------
A0A337SQV0_BBC3-02      MARARQEGSSP-EPVEGLARDGPRPFPLSRLVPSAVSC------------
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGN-------
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGN-------
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGN-------
A0A337SW42_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGN-------
                                                                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SAW2_BAD-01       RKRPRPLA--SPGDIS------KADWAGSVTVPVAQATRAGLPQYWREAA
A0A337SQV0_BBC3-01      PRRPAPLSPQPPGALGRVLRPLRARPARRPRRPRPAARRLPLRPHRPARR
A0A337SQ56_HRK-01       --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
M3WRS0_BMF-02           ----------LDCPLSHLQLFPLTHCCGPGLRPTSQEDKAT---------
M3WRS0_BMF-01           ----------LDCPLSHLQLFPLTHCCGPGLRPTSQEDKAT---------
A0A337SQV0_BBC3-02      ---------------GLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAAL
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      ----------PEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSS
A0A337SW42_BCL2L11      ----------PEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSS
A0A337SW42_BCL2L11      ----------PEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSS
A0A337SW42_BCL2L11      ----------PEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSS
                                                                          

A0A337SUX1_PMAIP1-      ------------------------------------MPGKRTRKSAQPS-
A0A337SAW2_BAD-01       GPGQGPRDRAWAQSMFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGK
A0A337SQV0_BBC3-01      HRRPGGPPLAWGSPQ-PAPRAAPRRSSALTLAGRAAPGIAGAQRPGGPGG
A0A337SQ56_HRK-01       ---------------------------------------------MCPC-
A0A337SQV0_BBC3-03      ---------------------------------PQPSLSPAEQHLESPV-
M3WRS0_BMF-02           ---------------------------------QTLSPASPSQGVMLPCG
M3WRS0_BMF-01           ---------------------------------QTLSPASPSQGVMLPCG
A0A337SQV0_BBC3-02      GGP-------------RWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPV-
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      ---------------------------DRSP--APMSCDKSTQTPSPPC-
A0A337SW42_BCL2L11      LLS-------------RSSSGYFSFDTDRSP--APMSCDKSTQTPSPPC-
A0A337SW42_BCL2L11      LLS-------------RSSSGYFSFDTDRSP--APMSCDKSTQTPSPPC-
A0A337SW42_BCL2L11      LLS-------------RSSSGYFSFDTDRSP--APMSCDKSTQTPSPPC-
A0A337SW42_BCL2L11      LLS-------------RSSSGYFSFDTDRSP--APMSCDKSTQTPSPPC-
                                                                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SAW2_BAD-01       HQRTTPGLLGEAGHQQGQPASSNHHGGAGAVETRSRHSSYPAGTEEDEGT
A0A337SQV0_BBC3-01      RP---------------HPGSPGSPGGGGAVGPGDRGPAAADGGRPQRAV
A0A337SQ56_HRK-01       -----------------PLHRGRGPPAVCACSAG----------------
A0A337SQV0_BBC3-03      -----------------PSAPGALAGGPTQAAPG----------------
M3WRS0_BMF-02           VTEEPQRLFYAPA----KPPSSVVADSPLPTQP-----------------
M3WRS0_BMF-01           VTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPP----------------
A0A337SQV0_BBC3-02      -----------------PSAPGALAGGPTQAAPG----------------
A0A337SW42_BCL2L11      ---------------------------ASMRQPQ----------------
A0A337SW42_BCL2L11      -----------------QAFNHYLSAMASMRQPQ----------------
A0A337SW42_BCL2L11      -----------------QAFNHYLSAMVRAIEEG----------------
A0A337SW42_BCL2L11      -----------------QAFNHYLSAM------G----------------
A0A337SW42_BCL2L11      -----------------QAFNHYLSAMASMRQPQ----------------
A0A337SW42_BCL2L11      -----------------QAFNHYLSAMASMRQPQ----------------
                                                                          

A0A337SUX1_PMAIP1-      -------------PARAPAEPEVECAMQLRRFGDKLNFRQKLMNLISKLF
A0A337SAW2_BAD-01       EEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFKGLP-----R
A0A337SQV0_BBC3-01      RAAET---RGAAATPPLTLEGPVQSHHGTPALTQGPRGPGDGAQLGACTR
A0A337SQ56_HRK-01       -------------RLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRR
A0A337SQV0_BBC3-03      -------------VRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQR
M3WRS0_BMF-02           ---------------GFECRREQEWGRSQ---------------------
M3WRS0_BMF-01           -------------EGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRR
A0A337SQV0_BBC3-02      -------------VRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQR
A0A337SW42_BCL2L11      -------------AVPADMRPEIWIAQELRRIGDEFNAYYPRRLARVPAS
A0A337SW42_BCL2L11      -------------AVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQ
A0A337SW42_BCL2L11      -------------VL-----------------------------------
A0A337SW42_BCL2L11      -------------LFE----------------------------------
A0A337SW42_BCL2L11      -------------AVPADMRPEIWIAQELRRIGDEFNAYYPRRLEQ----
A0A337SW42_BCL2L11      -------------AVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQ
                                                                          

A0A337SUX1_PMAIP1-      RSGT---------------------------------
A0A337SAW2_BAD-01       PKSAGTATQMRQSPSWTRFIQSWWDRNLGRGGSAPSQ
A0A337SQV0_BBC3-01      PVDVGDLGGRTLPPP---------DALASAGDFFCTM
A0A337SQ56_HRK-01       APAPGALPTYWPWLCAAAQVAALAAWLLGRRNL----
A0A337SQV0_BBC3-03      HRPSPWRVLYNLIMGLLPLPRARGAPEMEPN------
M3WRS0_BMF-02           -------------------------------------
M3WRS0_BMF-01           VWWQILLFLHNLALNAEENRNGAGPR-----------
A0A337SQV0_BBC3-02      HRPSPWRVLYNLIMGLLPLPRARGAPEMEPN------
A0A337SW42_BCL2L11      YI-----------------------------------
A0A337SW42_BCL2L11      AAEAQPQMIILRLLRYIVRLVWRLQ------------
A0A337SW42_BCL2L11      -------------------------------------
A0A337SW42_BCL2L11      -------------------------------------
A0A337SW42_BCL2L11      -------------------------------------
A0A337SW42_BCL2L11      AAEAQPQMIILRLLRYIVRLVWRLQ------------
                                                             

© 1998-2019