Dataset for protein Bmf of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M3WRS0_BMF-02      MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGL
M3WRS0_BMF-01      MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGL
                   ************************************************************

M3WRS0_BMF-02      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA----KPPSSVVADSPLPTQP
M3WRS0_BMF-01      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQP
                   *************************************. *      *:*. *. **  **

M3WRS0_BMF-02      ---GFECRREQEWGRSQ-------------------------------------------
M3WRS0_BMF-01      PEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVWWQILLFLHNLALNAEENRNG
                       :: * * : .*.                                            

M3WRS0_BMF-02      ----
M3WRS0_BMF-01      AGPR
                       

© 1998-2019