Dataset for protein Puma of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337SQV0_BBC3-03      --------------------------------YLGGGGLGESCVCARARC
A0A337SQV0_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
                                                           . ** *. : * . .

A0A337SQV0_BBC3-03      VGVTP--WVCVAC-----------------------------PQPSLSPA
A0A337SQV0_BBC3-02      PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPA
                         .: *  ::*..                              ********

A0A337SQV0_BBC3-03      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A337SQV0_BBC3-02      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
                        **************************************************

A0A337SQV0_BBC3-03      LYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN
A0A337SQV0_BBC3-02      LYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN
                        *******************************************

© 1998-2019