Dataset for protein Puma of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337SQV0_BBC3-03      YLGGGGLGESCV-----------CARARCVGVTP----------------
A0A337SQV0_BBC3-02      -----------------------MARARQEGSSPEPVEGLARDGP---RP
A0A337SQV0_BBC3-01      VYLSAGAARACPRQVPGASFFPGCPRERHGPSTPGGQLPGARRGPGPRRP
                                                .* *    :*                

A0A337SQV0_BBC3-03      --------------------------------------------------
A0A337SQV0_BBC3-02      FPLSRLVPSAVSCGL----------------------CEPGLPA----AP
A0A337SQV0_BBC3-01      APLSPQPPGALGRVLRPLRARPARRPRRPRPAARRLPLRPHRPARRHRRP
                                                                          

A0A337SQV0_BBC3-03      ------WVCVAC--------------------------------------
A0A337SQV0_BBC3-02      AAPALLPAAYLCAPTAPPAVTAAL----------GGPRWPGGPRSRPRGP
A0A337SQV0_BBC3-01      GGPPLAWGSPQPAPRAAPRRSSALTLAGRAAPGIAGAQRPGGPGGRPHPG
                                .                                         

A0A337SQV0_BBC3-03      ----PQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIG
A0A337SQV0_BBC3-02      RPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIG
A0A337SQV0_BBC3-01      SPGSP-----------------------GGGGAVGPGDRGP----AAADG
                            *                       **   ..** **     *   *

A0A337SQV0_BBC3-03      AQLRRMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRARGAP
A0A337SQV0_BBC3-02      AQLRRMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRARGAP
A0A337SQV0_BBC3-01      GRPQRAV----------RAAETRGAAATPPLTLEG------PVQSHHGTP
                        .. .* .          *  * .   .:*  .* .      *:   .*:*

A0A337SQV0_BBC3-03      EMEPN-------------------------------------------
A0A337SQV0_BBC3-02      EMEPN-------------------------------------------
A0A337SQV0_BBC3-01      ALTQGPRGPGDGAQLGACTRPVDVGDLGGRTLPPPDALASAGDFFCTM
                         :  .                                           

© 1998-2019