Dataset for protein Bad of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8Y761_BAD-01      MENIFTISDTESESSDVEETKKE----------------WIAGQGKTGSR
A0A3P9A5G8_BAD-02      --MAFKMDHTQDCVGDIPENINEKYDLDHLGTTHYPEFQFCNTSTNTSNR
A0A3P9A5G8_BAD-01      --MAFKMDHTQDCVGDIPENINEKYDLDHLGTTHYPEFQFCNTSTNTSNR
                           *.:. *:.  .*: *. :*                :   . :*..*

A0A3P8Y761_BAD-01      LGLSLNLPGEGRIRLNSESQVFATSGGERSGELQGLGQGLNCVATEGLPF
A0A3P9A5G8_BAD-02      -----TLPGV-RVRLYSESQVCSQVGRQDNTEFQVAMTPTEESGGDAAPF
A0A3P9A5G8_BAD-01      -----TLPGV-RVRLYSESQVCSQVGRQDNTEFQVAMTPTEESGGDAAPF
                            .***  *:** ***** :  * : . *:*      :  . :. **

A0A3P8Y761_BAD-01      RVRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGQMKRVKSAGAAKQMT
A0A3P9A5G8_BAD-02      RGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGIIPGRAKQV-
A0A3P9A5G8_BAD-01      RGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGIIPGRAKQV-
                       * *************.** ****************: **   .* ***: 

A0A3P8Y761_BAD-01      TSPSWWAFLFSHKETETEKTPNLIITEPRSSE
A0A3P9A5G8_BAD-02      -YRGWFSFLWSPKEAEGRD-------------
A0A3P9A5G8_BAD-01      -YRGWFSFLWSPKEAEGRD-------------
                          .*::**:* **:*  .             

© 1998-2019