Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6RS78_BIK-01      ------------------------------------------------------------
F7DN67_BAD-01      MGTPENPSPAPTHAQGTRKSTAEHPETRRGPRKEGGGRRAGPAAGSMFQIPEFEQSEPED
F6RS78_BIK-02      --------MRKRRRHAAAKRQTWDSNSGPLVSEPRSSSSYSV------------------
F6TJI0_BMF-02      --------MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPL
F6TJI0_BMF-01      --------MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPL
                                                                               

F6RS78_BIK-01      --------------------MSQVGPVSRDLFLDAFLHE------------RSPEALEVP
F7DN67_BAD-01      SSPADRGLGPSPTGDWPSDPVRHQRT-APGLLGEAGHQQGQPASSSHHGGAGAVETRSRH
F6RS78_BIK-02      ---------PKAVWSSVGEEMSQVGPVSRDLFLDAFLHE------------RSPEALEVP
F6TJI0_BMF-02      THCCGPGLRPTSQEDKATQTLSPASP-SQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFP
F6TJI0_BMF-01      THCCGPGLRPTSQEDKATQTLSPASP-SQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFP
                                       :    . : .::  .   :                . .  

F6RS78_BIK-01      GMTELTES------------------SPDSDNRD----SVAMRLAFIGDEMEVRWMLPHI
F7DN67_BAD-01      SSYPEGTEDEGMEGEEPGPFRGRSRSAPPNLWAAR---RYGRELRRMSDEFQ--------
F6RS78_BIK-02      GMTELTES------------------SPDSDNRD----SVAMRLAFIGDEMEVRWMLPHI
F6TJI0_BMF-02      AGLPLGEQ------------------PPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQ
F6TJI0_BMF-01      AGLPLGEQ------------------PPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQ
                   .      .                  .* . .        .  *  :.*::         

F6RS78_BIK-01      AELPGVAVYSLAFTYNQTGLRGVFRSFMDGLTNLRENIRFWSFLTRRDRVSLRFHDLDSP
F7DN67_BAD-01      ---------------------------------------------------VSFQALPRP
F6RS78_BIK-02      AELPGVAVYSLAFTYNQTGLRGVFRSFMDGLTNLRENIRFWSFLTRRDRVSLRFHDLDSP
F6TJI0_BMF-02      QNRNRVWWQTLLFLHN-----------------------------------LALNGDENR
F6TJI0_BMF-01      QNRNRVWWQTLLFLHN-----------------------------------LALNGDENR
                                                                      : ::     

F6RS78_BIK-01      SCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFACFTHSSSCLFPGPLGLRWLAY
F7DN67_BAD-01      KSAGTATQMRQS-----------PSWTRAIQSWWDRNLGRGGSAPSQ--------
F6RS78_BIK-02      SCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFACFTHSSSCLFPGPLGLRWLAY
F6TJI0_BMF-02      NGAGPSFQPGQEGVLWKS-----AGLQLPLSELLPFSPCCGTNGENLKQPVWLL-
F6TJI0_BMF-01      NGAGPRCGKNVRGPVREL-----ETSDLFLSCHPELPPAPGFCQDFVLS--WS--
                   .   .                        :.         .              

© 1998-2019