Dataset for protein Bmf of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6TJI0_BMF-02      MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGL
F6TJI0_BMF-01      MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGL
                   ************************************************************

F6TJI0_BMF-02      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQP
F6TJI0_BMF-01      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQP
                   ************************************************************

F6TJI0_BMF-02      PEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVWWQTLLFLHNLALNGDENRNG
F6TJI0_BMF-01      PEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVWWQTLLFLHNLALNGDENRNG
                   ************************************************************

F6TJI0_BMF-02      AGPSFQPGQEGVLWKSAGLQLPLSELLPFSPCCGTNGENLKQPVWLL
F6TJI0_BMF-01      AGPRCGKNVRGPVRELETSDLFLSCHPELPPAPGFCQDFVLS--WS-
                   ***    .  * :.:    :* **    :.*. *   : : .  *  

© 1998-2019