Dataset for protein classical BH3-containing proteins of organism Dipodomys ordii

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1S3EQA2_BMF-02       IVPGEMEPPQCVEELEDDVFQAEDGEPGTQPGSLLSATLFAQSQLDCPLS
A0A1S3EQA2_BMF-01       -----MEPPQCVEELEDDVFQAEDGEPGTQPGSLLSATLFAQSQLDCPLS
A0A1S3FHA8_BCL2L11      -----------MAKQPSDVSSECDREGGQLQPA-------ER--------
A0A1S3FHA8_BCL2L11      -----------MAKQPSDVSSECDREGGQLQPA-------ER--------
A0A1S3FL84_BAD-01       -----------MFQIPEFEPSEQEDSSSADRGL-----------------
A0A1S3FUQ7_BIK-01       ----------------------MSEAGSVTRDLFIKTLLYQQ--------
                                               .   .                      

A0A1S3EQA2_BMF-02       RLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS------------------
A0A1S3EQA2_BMF-01       RLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS------------------
A0A1S3FHA8_BCL2L11      -----------PPQLRPGAPTSLQTEQQGNPEGSPEGEGDRCPQGSPQGP
A0A1S3FHA8_BCL2L11      -----------PPQLRPGAPTSLQTEQQ----------------------
A0A1S3FL84_BAD-01       -----------GPSLCPAPGLLGDHSPQQGLPTSRSHHGGAGAVETRSRH
A0A1S3FUQ7_BIK-01       -----------MPGPRPAAGLFPITEPMG---------------------
                                    *   * .      .                        

A0A1S3EQA2_BMF-02       --------------------------------------PSQGVMLPCGVT
A0A1S3EQA2_BMF-01       --------------------------------------PSQGVMLPCGVT
A0A1S3FHA8_BCL2L11      LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKS
A0A1S3FHA8_BCL2L11      --------------------------------------DRSPAPMSCDKS
A0A1S3FL84_BAD-01       SSYPAGMEEDEGL-------------------------EEEPSPFRGRSR
A0A1S3FUQ7_BIK-01       --------------------------------------EEVWDPMDCLEG
                                                                    :     

A0A1S3EQA2_BMF-02       EEPQRLFYGSAGYRLPLPAGFPAAQQPPEGHRVEVQ----IARKLQCIAD
A0A1S3EQA2_BMF-01       EEPQRLFYGSAGYRLPLPAGFPAAQQPPEGHRVEVQ----IARKLQCIAD
A0A1S3FHA8_BCL2L11      TQTPSPPCQAFNHYLSAMASMRQSQEEPADLRPEIW----IAQELRRIGD
A0A1S3FHA8_BCL2L11      TQTPSPPCQAFNHYLSAMASMRQSQEEPADLRPEIW----IAQELRRIGD
A0A1S3FL84_BAD-01       SAPPN-----------------------------LWAARRYGRELRRMSD
A0A1S3FUQ7_BIK-01       SNQVA-----------------------------LW--------LVCIGD
                                                          :.        *  :.*

A0A1S3EQA2_BMF-02       QFHRLH--------------TQRHQQHRDRAWGQVLLFLHNLALNRENRD
A0A1S3EQA2_BMF-01       QFHRLH--------------TQRHQQHRDRAWGQVLLFLHNLALNRENRD
A0A1S3FHA8_BCL2L11      EFDAYY-----PRRVFLNNYQAAEDQPQMVILRLLRYIIRLV--------
A0A1S3FHA8_BCL2L11      EFDAYY-----PRRVFLNNYQAAEDQPQMVILRLLRYIIRLV--------
A0A1S3FL84_BAD-01       EFDGSFKGLPRPKSAGTATQ------------------MRQSSSWTRIFQ
A0A1S3FUQ7_BIK-01       EMDQRLRSPRLAQLPGMAIHSLALTYSQMGVWGVLRRLIRGVAHLRAHIR
                        ::                                    :.          

A0A1S3EQA2_BMF-02       RAGPR-------------------------------
A0A1S3EQA2_BMF-01       RAGPR-------------------------------
A0A1S3FHA8_BCL2L11      -WRMH-------------------------------
A0A1S3FHA8_BCL2L11      -WRMH-------------------------------
A0A1S3FL84_BAD-01       SWWDRNLGRGSAPSQ---------------------
A0A1S3FUQ7_BIK-01       AWRPPIPRLQVSPGQVRRQMLPAVLLLCGALQLLLQ
                                                            

© 1998-2018