Dataset for protein classical BH3-containing proteins of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q0GKC8_PMAIP1-01       ---------MAKKEQTAVVECA----------------------------
B2KKY9_BCL2L11-01      ---------MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGE
B8JK68_BCL2L11-01      ---------MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGE
E7FBJ6_BAD-01          MENTSHDHQDDSSTLDEKERSH--LKGTIKNHGQHQDRTSANISPQGRVR
Q0GKC7_BMF-01          ----------MDEDEDDVFRKG--L-----QHWPPPHLQIKQTELAGRPA
Q4V925_BAD-02          ---MAHMFNISDDSETETMEDS--EDSSLDKHKSGSAQKKQHLTVPDRLK
Q4V925_BAD-03          ---MAHMFNISDDSETETMEDS--EDSSLDKHKSGSAQKKQHLTVPDRLK
A7MCM4_BAD-01          ---MAHMFNISDDSETETMEDS--EASSLDKHKSGSAQKKQHLTVPDRLK
Q4V925_BAD-04          ---MAHMFNISDDSETETMEDS--EDSSLDKHKSGSAQKKQHLTVPDRLK
Q4V925_BAD-01          ---MAHMFNISDDSETETMEDS--EDSSLDKHKSGSAQKKQHLTVPDRLK
                                  .                                      

Q0GKC8_PMAIP1-01       --------------------------------------------------
B2KKY9_BCL2L11-01      GDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSDSVPGSPLMPNISEA
B8JK68_BCL2L11-01      GDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSDSVPGSPLMPNISEA
E7FBJ6_BAD-01          LYSESQVYTVSRWQD--------------------------------TET
Q0GKC7_BMF-01          GSRNGMLLCRHLQQH--------------------------------GHF
Q4V925_BAD-02          GEQLGRQRNLSMNEE--------------------------------DLL
Q4V925_BAD-03          GEQLGRQRNLSMNEE--------------------------------DLL
A7MCM4_BAD-01          GEQLGRQRNLSMNEE--------------------------------DLL
Q4V925_BAD-04          GEQLGRQRNLSMNEE--------------------------------DLL
Q4V925_BAD-01          GEQLGRQRNLSMNEE--------------------------------DLL
                                                                         

Q0GKC8_PMAIP1-01       ----------------------------------------------QQLR
B2KKY9_BCL2L11-01      QDGQND------------EVWLSEHSHQHLQMAAPVAALPPEMVVARELR
B8JK68_BCL2L11-01      QDGQND------------EVWLSEHSHQHLQMAAPVAALPPEMVVARELR
E7FBJ6_BAD-01          QDGASV------------EENGDGLPFRGRSQSAP-AALWKAKKYGRQLR
Q0GKC7_BMF-01          LYGNAELLVLAASSRAQPPDVVLRQNVSPMERPEPRPAQSVETLIGQKLQ
Q4V925_BAD-02          ETGVAE------------DPHMLGDPFRPRSRSAP-PALWAAKKYGQQLR
Q4V925_BAD-03          ETGVAE------------DPHMLGDPFRPRSRSAP-PALWAAKKYGQQLR
A7MCM4_BAD-01          ETGVAE------------DPHMLGDPFRPRSRSAP-PALWAAKKYGQQLR
Q4V925_BAD-04          ETGVAE------------DPHMLGDPFRPRSRSAP-PALWAAKKYGQQLR
Q4V925_BAD-01          ETGVAE------------DPHMLGDPFRPRSRSAP-PALWAAKKYGQQLR
                                                                     .:*.

Q0GKC8_PMAIP1-01       NIGDLL-----------------------NWKYKL---LELIVTLQKIQM
B2KKY9_BCL2L11-01      RIGDEFNRLYCEAGAGVNQLRAPNEHAIVLWMNVIIGRLVHFFLRRR---
B8JK68_BCL2L11-01      RIGDEFNRLYCEAGAGVNQLHAPNEHAIVLWMNDIIGRLVHFFLRRR---
E7FBJ6_BAD-01          RMSDEFDTW-LDKGVSKTPNSQKQTYR--GW-------FSFLWSPKEEEG
Q0GKC7_BMF-01          LIGDQFYQEHIMH-------HQRPQDP--LWRRVATAVLTLLFGARENRR
Q4V925_BAD-02          RMSDEFDKG-MKRVKSAGTARQMSQSP--SW-------LAFLWSHKESDA
Q4V925_BAD-03          RMSDEFDKG-MKRVKSAGTARQMSQSP--SW-------LAFLWSHKESDA
A7MCM4_BAD-01          RMSDEFDKGQMKRVKSAGTARQMSQSP--SW-------LAFLWSHKESDA
Q4V925_BAD-04          RMSDEFDKGQMKRVKSAGTARQMSQSP--SW-------LAFLWSHKESDA
Q4V925_BAD-01          RMSDEFDKGQMKRVKSAGTARQMSQSP--SW-------LAFLWSHKESDA
                        :.* :                        *       :  :   .    

Q0GKC8_PMAIP1-01       EGKR--
B2KKY9_BCL2L11-01      ------
B8JK68_BCL2L11-01      ------
E7FBJ6_BAD-01          RE----
Q0GKC7_BMF-01          ------
Q4V925_BAD-02          ESRPAE
Q4V925_BAD-03          ESRPAE
A7MCM4_BAD-01          ESRPAE
Q4V925_BAD-04          ESRPAE
Q4V925_BAD-01          ESRPAE
                             

© 1998-2019