Dataset for protein Bim of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B2KKY9_BCL2L11-01      MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDPLRGGIS
B8JK68_BCL2L11-01      MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDPLRGGIS
                       **************************************************

B2KKY9_BCL2L11-01      MSNNQSRSPMNRTFSRSSSGYFSVDSDSVPGSPLMPNISEAQDGQNDEVW
B8JK68_BCL2L11-01      MSNNQSRSPMNRTFSRSSSGYFSVDSDSVPGSPLMPNISEAQDGQNDEVW
                       **************************************************

B2KKY9_BCL2L11-01      LSEHSHQHLQMAAPVAALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLR
B8JK68_BCL2L11-01      LSEHSHQHLQMAAPVAALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLH
                       *************************************************.

B2KKY9_BCL2L11-01      APNEHAIVLWMNVIIGRLVHFFLRRR
B8JK68_BCL2L11-01      APNEHAIVLWMNDIIGRLVHFFLRRR
                       ************ *************

© 1998-2018