Dataset for protein Bad of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E7FBJ6_BAD-01      -MENTSHDHQDDSSTLDEKERSHLKGTIKNHGQHQDRTSANISPQGRVRLYSESQVYTVS
Q4V925_BAD-02      MAHMFNISDDSETETMEDSEDS----SLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLS
Q4V925_BAD-03      MAHMFNISDDSETETMEDSEDS----SLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLS
A7MCM4_BAD-01      MAHMFNISDDSETETMEDSEAS----SLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLS
Q4V925_BAD-04      MAHMFNISDDSETETMEDSEDS----SLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLS
Q4V925_BAD-01      MAHMFNISDDSETETMEDSEDS----SLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLS
                        . . :.::.*:::.* *    ::.:* . . ... :::  .*:.  . ..  .:*

E7FBJ6_BAD-01      RWQDTETQDGASVEENGDGLPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTW-LDKGVS
Q4V925_BAD-02      MNEEDLLETGVAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEFDKG-MKRVKS
Q4V925_BAD-03      MNEEDLLETGVAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEFDKG-MKRVKS
A7MCM4_BAD-01      MNEEDLLETGVAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKS
Q4V925_BAD-04      MNEEDLLETGVAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKS
Q4V925_BAD-01      MNEEDLLETGVAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKS
                    .::   : *.: : :  * *** **.***.*** *****.**********.  :..  *

E7FBJ6_BAD-01      KTPNSQKQTYRGWFSFLWSPKEEEGRE----
Q4V925_BAD-02      AGTARQMSQSPSWLAFLWSHKESDAESRPAE
Q4V925_BAD-03      AGTARQMSQSPSWLAFLWSHKESDAESRPAE
A7MCM4_BAD-01      AGTARQMSQSPSWLAFLWSHKESDAESRPAE
Q4V925_BAD-04      AGTARQMSQSPSWLAFLWSHKESDAESRPAE
Q4V925_BAD-01      AGTARQMSQSPSWLAFLWSHKESDAESRPAE
                     .  * .   .*::**** **.:. .    

© 1998-2018