Dataset for protein classical BH3-containing proteins of organism Cyprinodon variegatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2D5S0_BAD-01      MAQSVETSDPIMAATFTISDSDTEPSEEVEETRNKEPRIRNSGKTHRRIR
A0A3Q2E3E8_BMF-02      ---MEEEEDDVFEPD---PNSWHTPFREI-KFEDRGTQTPGPGVAPHNVM
A0A3Q2E3E8_BMF-01      ---MEEEEDDVFEPD---PNSWHTPFREI-KFEDRGTQTPGPGVAPHNVM
                            * .* :: .    .:*   *  *: :  :. ..  ..* : ..: 

A0A3Q2D5S0_BAD-01      LSSE---------------SHAFTREEEARGEEEVGTPTEGYPFRGRSNS
A0A3Q2E3E8_BMF-02      LPCGVVEEPRPLFYRNAGFRLHFPAHFELVGDFDVRRQAEHNRMEQLPLQ
A0A3Q2E3E8_BMF-01      LPCGVVEEPRPLFYRNAGFRLHFPAHFELVGDFDVRRQAEHNRMEQLPLQ
                       *..                   *.   *  *: :*   :*   :   . .

A0A3Q2D5S0_BAD-01      APPALWAAKKYGRQLRRMSDEFVTLLDKGELRKVSSTGTNRPIRHSKS--
A0A3Q2E3E8_BMF-02      QPAALSLEACIGQKLQIIGDQF----HREHLQQIPGQPFPHLVHQHQALT
A0A3Q2E3E8_BMF-01      QPAALSLEACIGQKLQIIGDQF----HREHLQQY------HQNQRNQG--
                        *.**      *.:*. :.*:*     .  *.:       .  .. :.  

A0A3Q2D5S0_BAD-01      ------WWSYLFSHQE------MEGENSHHENHTQCTEQRGE
A0A3Q2E3E8_BMF-02      LPPLPVYFSLLSPVVP------LCCGGKWH------------
A0A3Q2E3E8_BMF-01      ----PLWWRMTAALLSLLFDRGLIGGAGWR------------
                             ::    .         :     ..            

© 1998-2019