Dataset for protein Bmf of organism Cyprinodon variegatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2E3E8_BMF-02      MEEEEDDVFEPDPNSWHTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVE
A0A3Q2E3E8_BMF-01      MEEEEDDVFEPDPNSWHTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVE
                       **************************************************

A0A3Q2E3E8_BMF-02      EPRPLFYRNAGFRLHFPAHFELVGDFDVRRQAEHNRMEQLPLQQPAALSL
A0A3Q2E3E8_BMF-01      EPRPLFYRNAGFRLHFPAHFELVGDFDVRRQAEHNRMEQLPLQQPAALSL
                       **************************************************

A0A3Q2E3E8_BMF-02      EACIGQKLQIIGDQFHREHLQQIPGQPFPHLVHQHQALTLPPLPVYFSLL
A0A3Q2E3E8_BMF-01      EACIGQKLQIIGDQFHREHLQQY------HQNQRNQG------PLWWRMT
                       **********************       *  :.:*.      *::: : 

A0A3Q2E3E8_BMF-02      SPVVPL------CCGGKWH
A0A3Q2E3E8_BMF-01      AALLSLLFDRGLIGGAGWR
                       :.::.*        *. *.

© 1998-2019