Dataset for protein classical BH3-containing proteins of organism Cynoglossus semilaevis

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8UA78_BMF-01      MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGE
A0A3P8UA78_BMF-03      MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGE
A0A3P8UA78_BMF-02      MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGE
A0A3P8WIZ8_BAD-02      -MNVEVSIFPDVTMAAQFTISDSESE--------PEEEVEGGKIKHSLND
A0A3P8WIZ8_BAD-01      -------------MAAQFTISDSESE--------PEEEVEGGKIKHSLND
                                     : : *: :  .*        *:  ::.* :  .:.:

A0A3P8UA78_BMF-01      E------------PRPLFYGNAGFRLHFPAHFELIGDRETRRRQSDEERN
A0A3P8UA78_BMF-03      E------------PRPLFYGNAGFRLHFPAHFELIGDRETRRRQSDEERN
A0A3P8UA78_BMF-02      E------------PRPLFYGNAGFRLHFPAHFELIGDRETRRRQSDEERN
A0A3P8WIZ8_BAD-02      PEQVVPHRHNLTLPELRVAGSRRIRLNSESHASTISREEAFQSWGEEEAG
A0A3P8WIZ8_BAD-01      PEQVVPHRHNLTLPELRVAGSRRIRLNSESHASTISREEAFQSWGEEEAG
                                    *   . *.  :**:  :* . *.  *: . ..:** .

A0A3P8UA78_BMF-01      RMEPRPQQQQQQQRQQQQQPVQRSVEVRIGQKLQLIGDQFH-------RD
A0A3P8UA78_BMF-03      RMEPRPQQQQQQQRQQQQQPVQRSVEVRIGQKLQLIGDQFH-------RD
A0A3P8UA78_BMF-02      RMEPRPQQQQQQQRQQQQQPVQRSVEVRIGQKLQLIGDQFH-------RD
A0A3P8WIZ8_BAD-02      ----TPTEGAPFRGRSRSAPPALWAAKKYGRQLRRMSDEFDSLLDKGMRK
A0A3P8WIZ8_BAD-01      ----TPTEGAPFRGRSRSAPPALWAAKKYGRQLRRMSDEFDSLLDKGMRK
                            * :    . .... *    .  . *.:*. :.*:*        *.

A0A3P8UA78_BMF-01      HLQLYHRNQRNHGPLWWRLTTTLLSLLFNRGFFAGGGAAGRR------
A0A3P8UA78_BMF-03      HLQLYHRNQRNHGPLWWRLTTTLLSLLFNRGFFAGGGAAGRR------
A0A3P8UA78_BMF-02      HLQLYHRNQRNHGPLWWRLTTTLLSLLFNRGFFAGGGAAGRR------
A0A3P8WIZ8_BAD-02      VKSAGTARQMHHSKSWW-------SYLFSHQELEGENNHHENHTHRTE
A0A3P8WIZ8_BAD-01      VKSAGTARQMHHSKSWW-------SYLFSHQELEGENNHHENHTHRTE
                         .    .* :*.  **       * **..  : * .    .      

© 1998-2019