Dataset for protein Bmf of organism Cynoglossus semilaevis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8UA78_BMF-01      MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGE
A0A3P8UA78_BMF-03      MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGE
A0A3P8UA78_BMF-02      MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGE
                       **************************************************

A0A3P8UA78_BMF-01      EPRPLFYGNAGFRLHFPAHFELIGDRETRRRQSDEERNRMEPRPQQQQQQ
A0A3P8UA78_BMF-03      EPRPLFYGNAGFRLHFPAHFELIGDRETRRRQSDEERNRMEPRPQQQQQQ
A0A3P8UA78_BMF-02      EPRPLFYGNAGFRLHFPAHFELIGDRETRRRQSDEERNRMEPRPQQQQQQ
                       **************************************************

A0A3P8UA78_BMF-01      QRQQQQQPVQRSVEVRIGQKLQLIGDQFHRDHLQLYHRNQRNHGPLWWRL
A0A3P8UA78_BMF-03      QRQQQQQPVQRSVEVRIGQKLQLIGDQFHRDHLQLYHRNQRNHGPLWWRL
A0A3P8UA78_BMF-02      QRQQQQQPVQRSVEVRIGQKLQLIGDQFHRDHLQLYHRNQRNHGPLWWRL
                       **************************************************

A0A3P8UA78_BMF-01      TTTLLSLLFNRGFFAGGGAAGRR
A0A3P8UA78_BMF-03      TTTLLSLLFNRGFFAGGGAAGRR
A0A3P8UA78_BMF-02      TTTLLSLLFNRGFFAGGGAAGRR
                       ***********************

© 1998-2019