Dataset for protein Noxa of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5JY52_PMAIP1-      MPGKKARKNAQPSPARAQAELE----------------------------
A0A2K5JY52_PMAIP1-      MPGKKARKNAQPSPARAQAGTDPLGPAKTQAGRGRGRGKKLLSSPLALPR
                        *******************  :                            

A0A2K5JY52_PMAIP1-      -------------------------------------------VECATQL
A0A2K5JY52_PMAIP1-      GHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRNLTATKTCM
                                                                   .   * :

A0A2K5JY52_PMAIP1-      RRFGDKLNFRQ-KLLNLIAKLFCSGT
A0A2K5JY52_PMAIP1-      RGLQKRIFLRRCTFHQFEARLHCN--
                        * : ..: :*. .: :: *.*.*.  

© 1998-2018