Dataset for protein classical BH3-containing proteins of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5JY52_PMAIP1-      -------MPGKKARKNAQPSPARAQAELEVECATQLRRFGDK--------
A0A2K5JY52_PMAIP1-      -------MPGKKARKNAQPSPARAQAGTDPLGPAKTQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5KGR6_BMF-01       ----MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQS--------
A0A2K5KGR6_BMF-02       ----MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQS--------
A0A2K5J4Q7_BIK-01       -----------------MSGVRPISRDILMETLLYEQLLEPLTME-----
A0A2K5HKW9_BAD-01       -----------------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSD
A0A2K5HKW9_BAD-02       -----------------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSD
                                                                          

A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      ----------------------------AGRGRGRGKKLLSSPLALPRGH
A0A2K5HZI7_BCL2L11      -----------------TEPQ-----------------------------
A0A2K5HZI7_BCL2L11      -----------------TEPQ-----------------------------
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQ-----------------------------
A0A2K5HZI7_BCL2L11      -----------------TEPQ-----------------------------
A0A2K5KGR6_BMF-01       -----------LLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K5KGR6_BMF-02       -----------LLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K5J4Q7_BIK-01       -----------VLGVTDPEEDLDPMED------FDPLECMEDSDMLALRL
A0A2K5HKW9_BAD-01       SGKHHRQAPGLLWDASHQQEQATSSSHHGGAG-AVETRSRHSSHPAG---
A0A2K5HKW9_BAD-02       SGKHHRQAPGLLWDASHQQEQATSSSHHGGRAWYSPSESEDSENPSARML
                                                                          

A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      EEQVQVARSRVCYSTQEIWRQTE-----------------------LPAE
A0A2K5HZI7_BCL2L11      -------------------------------DRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      -------------------------------DRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      -------------------------------DRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      -------------------------------ASRRQAEPADMRPEIRIAQ
A0A2K5KGR6_BMF-01       PSQGVMLPCGVTEEPQRLFYAPAEPKSRVVADPPL---------------
A0A2K5KGR6_BMF-02       PSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAV----------LPI-
A0A2K5J4Q7_BIK-01       ACIGDEMDVSLRAPRLAQLSEVAMHSLGLA--------------------
A0A2K5HKW9_BAD-01       TEEDEGME----EEPSPFRGRSRSAPPNLW--------------------
A0A2K5HKW9_BAD-02       TEASAGMSAPATDSEAQHAENVKLEALGLWRPGVAT----------APTP
                                                                          

A0A2K5JY52_PMAIP1-      ------LNFRQKLLNLIAKLFCSGT-------------------------
A0A2K5JY52_PMAIP1-      TSESDSQTLLLRNLTATKTCMRGLQKRIFLRRCTFHQFEARLHCN-----
A0A2K5HZI7_BCL2L11      TPSPPCQAFN-HYLSAMVVILEDIGDTSLWFGFIFTGLDLYGHHHSQDTE
A0A2K5HZI7_BCL2L11      TPSPPCQAFN-HYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2K5HZI7_BCL2L11      TPSPPCQAFN-HYLSAMANWD-----------------------------
A0A2K5HZI7_BCL2L11      TPSPPCQAFN-HYLSAMGVFE-----------------------------
A0A2K5HZI7_BCL2L11      TPSPPCQAFN-HYLSAMVREIEEVVV------------------------
A0A2K5HZI7_BCL2L11      TPSPPCQAFN-HYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2K5HZI7_BCL2L11      TPSPPCQAFN-HYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2K5HZI7_BCL2L11      TPSPPCQAFN-HYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2K5HZI7_BCL2L11      TPSPPCQAFN-HYLSAMDEATGSSLRIALHREVQ----------------
A0A2K5HZI7_BCL2L11      ELRRIGDEFNAYYARRLAKLLASST-------------------------
A0A2K5KGR6_BMF-01       -PAQPCFEWR-REQERGGPQVRLGCPLHMGHQEHRQEGHRAGLTLCLVKL
A0A2K5KGR6_BMF-02       GEQPPEGQWQ-HRAEVQIAR-KLQCIADQFHRLHVQQHQQNRNRVWWQIL
A0A2K5J4Q7_BIK-01       FIYDQTDDIR-DVLRSFMDGFTTLKENIMRFWRSPNPGSRVSREQVLLAL
A0A2K5HKW9_BAD-01       AAQRYGRELR-RMSDEFVDSFKGLP-------RPKSAGTATQMRQSSSWT
A0A2K5HKW9_BAD-02       RGRRRTKGWR-RSPAPF--GAARAP-------RPLTSGQHSDMAASSGG-
                                                                          

A0A2K5JY52_PMAIP1-      ----------------------------------
A0A2K5JY52_PMAIP1-      ----------------------------------
A0A2K5HZI7_BCL2L11      QLNHRDFS--------------------------
A0A2K5HZI7_BCL2L11      RRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5HZI7_BCL2L11      ----------------------------------
A0A2K5HZI7_BCL2L11      ----------------------------------
A0A2K5HZI7_BCL2L11      ----------------------------------
A0A2K5HZI7_BCL2L11      RRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5HZI7_BCL2L11      RRMSLPPD--------------------------
A0A2K5HZI7_BCL2L11      RRLEK-----------------------------
A0A2K5HZI7_BCL2L11      ----------------------------------
A0A2K5HZI7_BCL2L11      ----------------------------------
A0A2K5KGR6_BMF-01       FFCCYFAF--------------------------
A0A2K5KGR6_BMF-02       LFLHNLALNGEENRNGAGPR--------------
A0A2K5J4Q7_BIK-01       LLLLALLLALLSGGLHLLLK--------------
A0A2K5HKW9_BAD-01       RVFQSWWDRNLGRGSSAPSQ--------------
A0A2K5HKW9_BAD-02       ----------------------------------
                                                          

© 1998-2019