Dataset for protein classical BH3-containing proteins of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5JY52_PMAIP1-      -------MPGKKARKNAQPSPARAQAELEVECATQLRRFGDKL-------
A0A2K5JY52_PMAIP1-      -------MPGKKARKNAQPSPARAQAGTDPLGPAKTQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI7_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5KGR6_BMF-01       ----MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQS--------
A0A2K5KGR6_BMF-02       ----MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQS--------
A0A2K5J4Q7_BIK-01       -----------------MSGVRPISRDILMETLLYEQLLEPLTME-----
A0A2K5HKW9_BAD-01       -----------------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSD
A0A2K5HKW9_BAD-02       -----------------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSD
                                                                          

A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      ----------------------------AGRGRGRGKKLLSSPLALPRGH
A0A2K5HZI7_BCL2L11      -----------------TEPQ-----------------------------
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI7_BCL2L11      -----------------TEPQ-----------------------------
A0A2K5HZI7_BCL2L11      -----------------TEPQ-----------------------------
A0A2K5HZI7_BCL2L11      -----------------TEPQ-----------------------------
A0A2K5KGR6_BMF-01       -----------LLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K5KGR6_BMF-02       -----------LLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K5J4Q7_BIK-01       -----------VLGVTDPEEDLDPMED------FDPLECMEDSDMLALRL
A0A2K5HKW9_BAD-01       SGKHHRQAPGLLWDASHQQEQATSSSHHGGAG-AVETRSRHSSHPAG---
A0A2K5HKW9_BAD-02       SGKHHRQAPGLLWDASHQQEQATSSSHHGGRAWYSPSESEDSENPSARML
                                                                          

A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      EE-------------------------QVQVARSRVCYSTQEIWRQTELP
A0A2K5HZI7_BCL2L11      -------------------------------DRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      -------------------------------ASRRQAEPADMRPEIRIAQ
A0A2K5HZI7_BCL2L11      -------------------------------DRSPAPMSCD-----KSTQ
A0A2K5HZI7_BCL2L11      -------------------------------DRSPAPMSCD-----KSTQ
A0A2K5KGR6_BMF-01       PSQGVMLPCGVTEEPQRLFYAPAEPKSRVVADPPL---------------
A0A2K5KGR6_BMF-02       PSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAV----------LPI-
A0A2K5J4Q7_BIK-01       ACIGDEMDVSLRAPRLAQLSEVAMHSLGLA--------------------
A0A2K5HKW9_BAD-01       TEEDEGME----EEPSPFRGRSRSAPPNLW--------------------
A0A2K5HKW9_BAD-02       TEASAGMSAPATDSEAQHAENVKLEALGLWRPGVAT----------APTP
                                                                          

A0A2K5JY52_PMAIP1-      -------NFRQKLLNLIAKLFCSGT-------------------------
A0A2K5JY52_PMAIP1-      AETSESDSQTLLLRNLTATKTCMRGLQKRIFLRRCTFHQFEARLHCN---
A0A2K5HZI7_BCL2L11      TPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYAR
A0A2K5HZI7_BCL2L11      TPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYAR
A0A2K5HZI7_BCL2L11      TPSPPCQAFNHYLSAMVREIEEVVV-------------------------
A0A2K5HZI7_BCL2L11      TPSPPCQAFNHYLSAMGVFE------------------------------
A0A2K5HZI7_BCL2L11      TPSPPCQAFNHYLSAMANWD------------------------------
A0A2K5HZI7_BCL2L11      TPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYAR
A0A2K5HZI7_BCL2L11      TPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYAR
A0A2K5HZI7_BCL2L11      ELRRIGDEFNAYYARRLAKLLASST-------------------------
A0A2K5HZI7_BCL2L11      TPSPPCQAFNHYLSAM----DEATGSSLRIAL------------------
A0A2K5HZI7_BCL2L11      TPSPPCQAFNHYLSAMVVILEDIGDTSLWFGFIFTGLDLYGHHHSQDTEQ
A0A2K5KGR6_BMF-01       -PAQPCFEWRREQERGGPQVRLGCPLHMGHQEHRQEGHRAGLTLCLVKLF
A0A2K5KGR6_BMF-02       GEQPPEGQWQHRAEVQIAR-KLQCIADQFHRLHVQQHQQNRNRVWWQILL
A0A2K5J4Q7_BIK-01       FIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVSREQVLLALL
A0A2K5HKW9_BAD-01       AAQRYGRELRRMSDEFVDSFKGLP-------RPKSAGTATQMRQSSSWTR
A0A2K5HKW9_BAD-02       RGRRRTKGWRRSPAPF--GAARAP-------RPLTSGQHSDMAASSGG--
                                                                          

A0A2K5JY52_PMAIP1-      ---------------------------------
A0A2K5JY52_PMAIP1-      ---------------------------------
A0A2K5HZI7_BCL2L11      RVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5HZI7_BCL2L11      RVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5HZI7_BCL2L11      ---------------------------------
A0A2K5HZI7_BCL2L11      ---------------------------------
A0A2K5HZI7_BCL2L11      ---------------------------------
A0A2K5HZI7_BCL2L11      RMSLPPD--------------------------
A0A2K5HZI7_BCL2L11      RLEK-----------------------------
A0A2K5HZI7_BCL2L11      ---------------------------------
A0A2K5HZI7_BCL2L11      --HREVQ--------------------------
A0A2K5HZI7_BCL2L11      LNHRDFS--------------------------
A0A2K5KGR6_BMF-01       FCCYFAF--------------------------
A0A2K5KGR6_BMF-02       FLHNLALNGEENRNGAGPR--------------
A0A2K5J4Q7_BIK-01       LLLALLLALLSGGLHLLLK--------------
A0A2K5HKW9_BAD-01       VFQSWWDRNLGRGSSAPSQ--------------
A0A2K5HKW9_BAD-02       ---------------------------------
                                                         

© 1998-2018